DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10839 and Lrrc23

DIOPT Version :9

Sequence 1:	NP_001246039.1	Gene:	CG10839 / 34944	FlyBaseID:	FBgn0028858	Length:	182	Species:	Drosophila melanogaster
Sequence 2:	XP_006505721.1	Gene:	Lrrc23 / 16977	MGIID:	1315192	Length:	370	Species:	Mus musculus

Alignment Length:	140	Identity:	43/140 - (30%)
Similarity:	71/140 - (50%)	Gaps:	8/140 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly    40 MDPILNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNN 104
            :||  ..|:....|.|..|.:|...||. :..||.|.||:|.||.:.|:|.|:: |..|.:..|.
Mouse   200 LDP--ERLSSLHTLELRGNQLESTKGIY-LPKLKNLYLAQNLLKKVEGLENLSN-LTTLHLRDNQ 260

  Fly   105 IEKTKPL-ESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRR 168
            ||..... :.||:|:...:..|||.|..|..::...|.|..:..:.||.   .|::.:..||:.:
Mouse   261 IETLNGFSQEMKSLQYLNLRSNMISDLAELAKLRDLPKLRALVLLDNPC---ADETDYRQEALVQ 322

  Fly   169 LPNMKKLDGE 178
            :.::::||.|
Mouse   323 MAHLERLDKE 332

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10839	NP_001246039.1	LRR_RI	<37..129	CDD:238064	31/89 (35%)
		LRR_4	48..90	CDD:289563	15/41 (37%)
		leucine-rich repeat	50..71	CDD:275380	6/20 (30%)
		LRR_8	51..105	CDD:290566	20/53 (38%)
		leucine-rich repeat	72..94	CDD:275380	11/21 (52%)
		leucine-rich repeat	95..116	CDD:275380	6/21 (29%)
		leucine-rich repeat	117..141	CDD:275380	6/23 (26%)
		leucine-rich repeat	142..171	CDD:275380	6/28 (21%)
Lrrc23	XP_006505721.1	leucine-rich repeat	100..119	CDD:275380
		internalin_A	105..>311	CDD:380193	37/117 (32%)
		leucine-rich repeat	120..141	CDD:275380
		leucine-rich repeat	142..162	CDD:275380
		leucine-rich repeat	163..183	CDD:275380
		leucine-rich repeat	184..207	CDD:275380	3/8 (38%)
		leucine-rich repeat	208..228	CDD:275380	6/20 (30%)
		leucine-rich repeat	229..250	CDD:275380	11/20 (55%)
		leucine-rich repeat	251..273	CDD:275380	6/21 (29%)
		leucine-rich repeat	274..298	CDD:275380	6/23 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0531
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810