DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and K10D2.8

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001254924.1 Gene:K10D2.8 / 13189483 WormBaseID:WBGene00189952 Length:335 Species:Caenorhabditis elegans


Alignment Length:178 Identity:50/178 - (28%)
Similarity:82/178 - (46%) Gaps:36/178 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPLA-- 92
            |:|....|:||:. |:.|...::|.|.:|.|.||.|:.||..||.|||..|.|:.:.|::.|:  
 Worm   142 LEFGDNRIQKMEN-LSHLVNLERLFLGANQIRKIEGLDGMAQLKELSLPGNALQIIEGLDTLSGL 205

  Fly    93 -------------------DTLEELWVSYNNIEKTKPLESMKALRVFYISFNMIKDWTEFMRMGV 138
                               ..|:.|.::.|.|||.:.:|..|.:....|..|.:..|.:..::..
 Worm   206 KSISLAQNGIRKIDGLSGLTNLKSLDLNDNIIEKLENVEQFKGISSLMIRKNKLNCWQDVRQLKK 270

  Fly   139 PPNLSEITFVGNPLNENMDQSAFTAEAVRR------LPNMKKLDGEPV 180
            ..||:.:|...|||        ::::...|      ||::|.|||.|:
 Worm   271 LENLTVLTMEMNPL--------YSSDYTYRNRVKEILPDVKLLDGFPI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 33/112 (29%)
LRR_4 48..90 CDD:289563 17/41 (41%)
leucine-rich repeat 50..71 CDD:275380 9/20 (45%)
LRR_8 51..105 CDD:290566 21/74 (28%)
leucine-rich repeat 72..94 CDD:275380 9/42 (21%)
leucine-rich repeat 95..116 CDD:275380 7/20 (35%)
leucine-rich repeat 117..141 CDD:275380 3/23 (13%)
leucine-rich repeat 142..171 CDD:275380 7/34 (21%)
K10D2.8NP_001254924.1 leucine-rich repeat 30..50 CDD:275380
LRR_4 49..90 CDD:289563
leucine-rich repeat 51..72 CDD:275380
LRR_8 71..127 CDD:290566
LRR_4 71..113 CDD:289563
leucine-rich repeat 73..94 CDD:275380
LRR_4 94..134 CDD:289563
leucine-rich repeat 95..116 CDD:275380
LRR_4 116..157 CDD:289563 6/15 (40%)
leucine-rich repeat 117..138 CDD:275380
leucine-rich repeat 139..160 CDD:275380 7/18 (39%)
LRR_4 160..199 CDD:289563 16/38 (42%)
leucine-rich repeat 161..182 CDD:275380 9/20 (45%)
LRR_8 182..235 CDD:290566 11/52 (21%)
leucine-rich repeat 183..204 CDD:275380 9/20 (45%)
LRR_4 205..245 CDD:289563 6/39 (15%)
leucine-rich repeat 205..226 CDD:275380 0/20 (0%)
leucine-rich repeat 252..273 CDD:275380 3/20 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.