DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and DNAAF1

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_011521155.1 Gene:DNAAF1 / 123872 HGNCID:30539 Length:772 Species:Homo sapiens


Alignment Length:167 Identity:40/167 - (23%)
Similarity:80/167 - (47%) Gaps:33/167 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIE--PLA 92
            |..|...|:|::. |.:.||.:.|.|..|::.||..:..::.|..|:|:.|.:||:..:.  |:.
Human   134 LWLQSNGIQKIEN-LEAQTELRCLFLQMNLLRKIENLEPLQKLDALNLSNNYIKTIENLSCLPVL 197

  Fly    93 DTLEELWVSYNNIEKTKPLESMK---ALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNE 154
            :||:   :::|::|..:.::.::   .|.|..:|.|.:.|......:...|:|..:..:|||:  
Human   198 NTLQ---MAHNHLETVEDIQHLQECLRLCVLDLSHNKLSDPEILSILESMPDLRVLNLMGNPV-- 257

  Fly   155 NMDQSAFTAEAVRRLPNMKK-----------LDGEPV 180
                       :|::||.::           ||..||
Human   258 -----------IRQIPNYRRTVTVRLKHLTYLDDRPV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 25/96 (26%)
LRR_4 48..90 CDD:289563 13/43 (30%)
leucine-rich repeat 50..71 CDD:275380 5/20 (25%)
LRR_8 51..105 CDD:290566 15/55 (27%)
leucine-rich repeat 72..94 CDD:275380 7/23 (30%)
leucine-rich repeat 95..116 CDD:275380 3/23 (13%)
leucine-rich repeat 117..141 CDD:275380 5/23 (22%)
leucine-rich repeat 142..171 CDD:275380 5/28 (18%)
DNAAF1XP_011521155.1 leucine-rich repeat 111..130 CDD:275380
LRR_4 129..171 CDD:289563 12/37 (32%)
LRR_8 151..207 CDD:290566 17/58 (29%)
LRR_4 151..192 CDD:289563 13/40 (33%)
leucine-rich repeat 153..174 CDD:275380 5/20 (25%)
LRR_4 173..215 CDD:289563 11/44 (25%)
leucine-rich repeat 175..196 CDD:275380 6/20 (30%)
LRR_8 195..257 CDD:290566 14/64 (22%)
leucine-rich repeat 197..221 CDD:275380 4/26 (15%)
LRR_4 221..263 CDD:289563 11/54 (20%)
leucine-rich repeat 222..243 CDD:275380 5/20 (25%)
leucine-rich repeat 247..274 CDD:275380 7/39 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.