DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and LRRC56

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_932341.1 Gene:LRRC56 / 115399 HGNCID:25430 Length:542 Species:Homo sapiens


Alignment Length:143 Identity:41/143 - (28%)
Similarity:70/143 - (48%) Gaps:11/143 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LTECQKLSLSSNMIEKITGI-SGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKP 110
            |....:|.|:.:.:..:..: :.:.:|:||.|||..|..|:||..| ..|:||:.|||||....|
Human    92 LPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWLARCGLADLDGIASL-PALKELYASYNNISDLSP 155

  Fly   111 LESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGN---------PLNENMDQSAFTAEAV 166
            |..::.|.|..:..|.::|..:...:.:.|.|:.:|..||         |.|:......:.||..
Human   156 LCLLEQLEVLDLEGNSVEDLGQVRYLQLCPRLAMLTLEGNLVCLQPAPGPT
NKVPRGYNYRAEVR 220

  Fly   167 RRLPNMKKLDGEP 179
            :.:|.::.||..|
Human   221 KLIPQLQVLDEVP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 27/82 (33%)
LRR_4 48..90 CDD:289563 12/42 (29%)
leucine-rich repeat 50..71 CDD:275380 2/21 (10%)
LRR_8 51..105 CDD:290566 19/54 (35%)
leucine-rich repeat 72..94 CDD:275380 11/21 (52%)
leucine-rich repeat 95..116 CDD:275380 10/20 (50%)
leucine-rich repeat 117..141 CDD:275380 4/23 (17%)
leucine-rich repeat 142..171 CDD:275380 8/37 (22%)
LRRC56NP_932341.1 LRR_RI <54..186 CDD:238064 28/94 (30%)
LRR 1 94..115 2/20 (10%)
leucine-rich repeat 95..117 CDD:275380 2/21 (10%)
LRR_8 117..170 CDD:290566 23/53 (43%)
LRR_4 117..156 CDD:289563 19/39 (49%)
LRR 2 117..138 11/21 (52%)
leucine-rich repeat 118..139 CDD:275380 11/21 (52%)
LRR_4 138..175 CDD:289563 13/36 (36%)
LRR 3 139..160 10/20 (50%)
leucine-rich repeat 140..161 CDD:275380 10/20 (50%)
LRR 4 161..182 4/20 (20%)
leucine-rich repeat 162..186 CDD:275380 4/23 (17%)
LRR 5 186..206 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..377
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 396..475
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 507..542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.