DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and Lrrc49

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_663591.3 Gene:Lrrc49 / 102747 MGIID:2442689 Length:752 Species:Mus musculus


Alignment Length:190 Identity:46/190 - (24%)
Similarity:85/190 - (44%) Gaps:47/190 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LQFQYPPIEKMDPILNSLTECQKLSLSSNMIEKITGISGMKNLKVLSLARNNLKTLNGIEPL--- 91
            |.||:..|.::..|.| |.....|.|..|.||:|:|:|.:|:|:||.|.:|.:|.::.:|.|   
Mouse   183 LNFQHNFITRIQNISN-LQRLIFLDLYDNQIEEISGLSTLKSLRVLLLGKNRIKKISNLENLKNL 246

  Fly    92 ----------------------------------------ADTLEELWVSYNNIEKTKPLESMKA 116
                                                    .|:|.||.:.:|.|...:.::::..
Mouse   247 DVLDLHGNQITKIENVNHLCDLRVLNLARNLLSHVDNLNGLDSLTELNLRHNQITFVRDVDNLPC 311

  Fly   117 LRVFYISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKLD 176
            |:..::|||.|..:.....:....:||:|||.|||:.:   :|.:....::.:..:::||
Mouse   312 LQRLFLSFNNITSFESVSCLAESTSLSDITFDGNPIAQ---ESWYKHTVLQNMMQLRQLD 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 32/134 (24%)
LRR_4 48..90 CDD:289563 15/41 (37%)
leucine-rich repeat 50..71 CDD:275380 8/20 (40%)
LRR_8 51..105 CDD:290566 22/96 (23%)
leucine-rich repeat 72..94 CDD:275380 8/64 (13%)
leucine-rich repeat 95..116 CDD:275380 5/20 (25%)
leucine-rich repeat 117..141 CDD:275380 5/23 (22%)
leucine-rich repeat 142..171 CDD:275380 9/28 (32%)
Lrrc49NP_663591.3 leucine-rich repeat 160..177 CDD:275380
LRR_4 178..219 CDD:289563 14/36 (39%)
leucine-rich repeat 180..201 CDD:275380 7/18 (39%)
LRR_4 200..242 CDD:289563 15/41 (37%)
leucine-rich repeat 202..223 CDD:275380 8/20 (40%)
LRR_8 222..278 CDD:290566 9/55 (16%)
LRR_4 222..264 CDD:289563 9/41 (22%)
leucine-rich repeat 224..245 CDD:275380 8/20 (40%)
LRR_4 244..286 CDD:289563 0/41 (0%)
leucine-rich repeat 246..267 CDD:275380 0/20 (0%)
LRR_8 268..322 CDD:290566 10/53 (19%)
leucine-rich repeat 268..289 CDD:275380 0/20 (0%)
LRR_4 289..329 CDD:289563 10/39 (26%)
leucine-rich repeat 290..311 CDD:275380 5/20 (25%)
leucine-rich repeat 312..336 CDD:275380 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.