DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10839 and cntrl

DIOPT Version :9

Sequence 1:NP_001246039.1 Gene:CG10839 / 34944 FlyBaseID:FBgn0028858 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_004919852.2 Gene:cntrl / 100270771 XenbaseID:XB-GENE-959037 Length:2448 Species:Xenopus tropicalis


Alignment Length:164 Identity:43/164 - (26%)
Similarity:78/164 - (47%) Gaps:24/164 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ATEIGLQFQYPPIEKMDPILNSLTECQK---LSLSSNMIEKITGISGMKNLKVLSLARNNLKTLN 86
            |.|.|.:|::         :.:|.:|::   |:||.|:||||..:.....|:.|:||.|.:..:.
 Frog   187 AKEGGKKFKF---------IENLEKCERLEVLNLSHNLIEKIEKLEKQIRLRELNLAYNKISKIE 242

  Fly    87 GIEPLADTLEELWVSYNNIEKT-----KPLESMKALRVFYISFNMIKDWTEFMRMGVPPNLSEIT 146
            ..|.: ..|::|.::.|.||..     |.|:|:.||.   :..|.|....:..|:....:|:.::
 Frog   243 HFEHM-QNLKKLNLAGNEIEHIPVWVGKKLKSLTALN---LKENRISSLQDVSRLKPLKDLTTLS 303

  Fly   147 FVGNPLNENMDQSAFTAEAVRRLPNMKKLDGEPV 180
            ...||::.......:|   |..|.::..||.:||
 Frog   304 LSDNPVSNLPHYRLYT---VFHLRSLNSLDAQPV 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10839NP_001246039.1 LRR_RI <37..129 CDD:238064 28/99 (28%)
LRR_4 48..90 CDD:289563 14/44 (32%)
leucine-rich repeat 50..71 CDD:275380 9/23 (39%)
LRR_8 51..105 CDD:290566 17/56 (30%)
leucine-rich repeat 72..94 CDD:275380 6/21 (29%)
leucine-rich repeat 95..116 CDD:275380 8/25 (32%)
leucine-rich repeat 117..141 CDD:275380 4/23 (17%)
leucine-rich repeat 142..171 CDD:275380 6/28 (21%)
cntrlXP_004919852.2 PPP1R42 197..340 CDD:411060 39/145 (27%)
leucine-rich repeat 206..227 CDD:275378 8/20 (40%)
leucine-rich repeat 228..249 CDD:275378 6/21 (29%)
leucine-rich repeat 250..273 CDD:275378 7/22 (32%)
leucine-rich repeat 274..298 CDD:275378 5/26 (19%)
leucine-rich repeat 299..312 CDD:275378 3/12 (25%)
SMC_prok_B <498..1133 CDD:274008
Smc 1399..2229 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.