DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18063 and spata17

DIOPT Version :9

Sequence 1:NP_001162988.1 Gene:CG18063 / 34943 FlyBaseID:FBgn0028856 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001135736.1 Gene:spata17 / 799739 ZFINID:ZDB-GENE-111214-1 Length:357 Species:Danio rerio


Alignment Length:317 Identity:78/317 - (24%)
Similarity:125/317 - (39%) Gaps:69/317 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DLTRVQSVILD-------YKQFKAARTIQRYIHGWLVRENFRKLQKSAIIIQKWWRRFEAQKNLL 100
            ||.:.|..|.:       .|:.:||..||.:..|..||...|.|.|:||:|||.||.|.|:....
Zfish    13 DLIKEQHFIRNRIAEENRQKENEAAVRIQSWFRGCQVRAYIRHLHKNAILIQKTWRGFTARALFR 77

  Fly   101 YVAESALQSAVLAHYDKSATLIQTLYRGWWSRKHIFDLTMLKSVQIMLAKDLIHSLVNYLHA-TK 164
            ...::|.....:..|:|.|..||..:||::.||::.:....|               .||.. |:
Zfish    78 QRVKTAYFIMKMNFYNKMAVKIQQRWRGFYVRKYVHNYYARK---------------RYLEGLTR 127

  Fly   165 NSEMLPGIYTIRDSSICLETLEELMATFGFRFYNANACYKMKETLSMVAQSRKTFTATSYFTDVP 229
            .:|     :..||       ||| .|.|..|.....|..|.::...:.||......:|.     .
Zfish   128 KNE-----HIRRD-------LEE-FAEFQRRERERIALEKEEQEKKIQAQRLHFLLSTK-----Q 174

  Fly   230 YPGFNDRGFCGPRQNSAMTLNAKDPEHYELIHIFLSGSRKIGMTTAKLEQKIANIAEE------N 288
            .||..:..|            ..:|:..||   .|...:.:.:.:|..|:|..||..:      |
Zfish   175 CPGVFNSPF------------RAEPDEMEL---RLRTVKPLLVRSAPKERKTPNITPDLSSVMPN 224

  Fly   289 RLNMFIKRDNKKKSFIKRIYLDMKNWHYSNGDPILPISLFKNSEMPAVLESAKKTLE 345
            |..  :...:||.....|..|:::...|...:|.|.::    :.:.| ||.|::.|:
Zfish   225 RER--LPPIHKKTQGPFRPALEVQQQRYRPLEPSLRVA----TSITA-LEEAREELK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18063NP_001162988.1 IQ 78..99 CDD:197470 11/20 (55%)
spata17NP_001135736.1 COG5022 <87..>161 CDD:227355 24/101 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592589
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXK
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22706
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.