DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18063 and CG31735

DIOPT Version :9

Sequence 1:NP_001162988.1 Gene:CG18063 / 34943 FlyBaseID:FBgn0028856 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_723937.3 Gene:CG31735 / 318922 FlyBaseID:FBgn0051735 Length:312 Species:Drosophila melanogaster


Alignment Length:268 Identity:81/268 - (30%)
Similarity:134/268 - (50%) Gaps:20/268 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 FKAARTIQRYIHGWLVRENFRKLQKSAIIIQKWWRRFEAQKNLLYVAESALQSAVLAHYDKSATL 121
            |.|||.||.:..|:.||:......:|||.||:|||.|..:..|....|..||..:..|:.::|..
  Fly     2 FIAARRIQSFWRGYRVRKLLHLRWQSAIAIQRWWRGFRTRHILYEKVERRLQGIIHEHFHRAAIR 66

  Fly   122 IQTLYRGWWSRKHIFDLTMLKSVQIMLAKDLIHSLVNYLHATKNSEMLPGIYTIRDSSICLETLE 186
            ||.|:||||.||.|.|:..|..:|...|:|||:.:::.:|..|.::.:||:.::| :|:|...:|
  Fly    67 IQALFRGWWVRKFIHDVRNLHRMQCTAAEDLINCIIHEMHHIKKTDSIPGVISLR-NSVCRSKVE 130

  Fly   187 ELMATFGFRFYNANACYKMKETLSMVAQSRKTFTATSYFTDVPYPGFNDRGFCGPRQNSAMTLN- 250
            :|:.|..|||:|......:...:|...:.|:.|....:.|.:||.|.|..|.|..|::..:.|. 
  Fly   131 KLLTTMIFRFHNGRVLSMVANRMSQKEEYRRHFRDARFVTHIPYSGPNFDGLCYVREDDHIVLKE 195

  Fly   251 -AKDPEHYELI--------HIFLSGSRKIGMTTAKLEQKIANIAEENRLNMFIKRDNKKKSFIKR 306
             ..|..:.|::        |..|..:. :.....||:::|.:|   |...:.:||     .|...
  Fly   196 VPTDLRYSEIVTEYEESQLHEHLRETH-LRFDLRKLQRQIDHI---NYQELHLKR-----KFCAD 251

  Fly   307 IYLDMKNW 314
            :...|:.|
  Fly   252 VIDRMRKW 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18063NP_001162988.1 IQ 78..99 CDD:197470 9/20 (45%)
CG31735NP_723937.3 COG5022 <4..>79 CDD:227355 31/74 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464971
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXK
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014388
OrthoInspector 1 1.000 - - otm47562
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.