DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18063 and SPATA17

DIOPT Version :9

Sequence 1:NP_001162988.1 Gene:CG18063 / 34943 FlyBaseID:FBgn0028856 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001362584.1 Gene:SPATA17 / 128153 HGNCID:25184 Length:361 Species:Homo sapiens


Alignment Length:359 Identity:81/359 - (22%)
Similarity:135/359 - (37%) Gaps:98/359 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KQFKAARTIQRYIHGWLVRENFRKLQKSAIIIQKWWRRFEAQKNLLYVAESALQSAVLAHYDKSA 119
            |:..||..||.:..|..||...|.|.:...|||||||.|..:|......:.|..:.::..|:..|
Human    31 KENDAAVKIQSWFRGCQVRAYIRHLNRIVTIIQKWWRSFLGRKQYQLTVQVAYYTMMMNLYNAMA 95

  Fly   120 TLIQTLYRGWWSRKHIFDLTMLKSVQIMLAK--DLIHSL-------------------------- 156
            ..||..:||:..||::|:...||....::::  |.|...                          
Human    96 VRIQRRWRGYRVRKYLFNYYYLKEYLKVVSETNDAIRKALEEFAEMKEREEKKANLEREEKKRDY 160

  Fly   157 ----VNYLHATKNSEMLPGIYT--IRDS----SICLETLEELMATFGFRFYNANACYKMKETLS- 210
                ::||.:||   .:||||.  .|..    .:.|:..:.|.        :.....|.|::.| 
Human   161 QARKMHYLLSTK---QIPGIYNSPFRKEPDPWELQLQKAKPLT--------HRRPKVKQKDSTSL 214

  Fly   211 ---MVAQSRKTFTATSYFTDVPYPGFNDRGFCGPRQNSAMTLNAKDPEHYELIHIFLSGSR---- 268
               :...|.::|..:...     |..|.:...||.::....|.    :.|..:...|..:.    
Human   215 TDWLACTSARSFPRSEIL-----PPINRKQCQGPFRDITEVLE----QRYRPLEPTLRVAEPIDE 270

  Fly   269 -KIGMTTAKLEQKIANIAEENRLNMFI--KRDNKKKSFIKRIYLDMKNWHYSNGDPILPISLFK- 329
             |:.....:.|:.:.|:.:    |||:  ...:|.:.:|..::|..|   |.      ||| :| 
Human   271 LKLAREELRREEWLQNVND----NMFLPFSSYHKNEKYIPSMHLSSK---YG------PIS-YKE 321

  Fly   330 --NSEMP----------AVLESAKKTLESIFGEL 351
              .||.|          .||.|.:  |.|.:|:|
Human   322 QFRSENPKKWICDKDFQTVLPSFE--LFSKYGKL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18063NP_001162988.1 IQ 78..99 CDD:197470 10/20 (50%)
SPATA17NP_001362584.1 IQ 55..76 CDD:197470 10/20 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156947
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXK
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto91750
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22706
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.