DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12448 and Spata17

DIOPT Version :9

Sequence 1:NP_723942.2 Gene:CG12448 / 34942 FlyBaseID:FBgn0028857 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_083124.1 Gene:Spata17 / 74717 MGIID:1921967 Length:379 Species:Mus musculus


Alignment Length:390 Identity:83/390 - (21%)
Similarity:146/390 - (37%) Gaps:108/390 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LESNSSQDSYFGQSSRLK----LALL-------------------DYKQF--NAARTIQCHVRGF 77
            :|:||:.   ||:...||    ||.|                   .:::|  :||..||...||.
Mouse     1 METNSNN---FGELQELKDMATLAKLLARAPFLESQYYFRNRAVDSFRKFENDAAVMIQSWFRGC 62

  Fly    78 LARSTLKRQIDAATIISKWWRGFWVRHSKFSFMQQLLQQRI----IQYHHDMATKIQALFRGWMT 138
            ..|:.::......|||.||||.:..|    .|.|.:::...    :..:::||.:||..:||:..
Mouse    63 QVRAYMRHLNRVVTIIQKWWRSYLGR----KFYQLVVEAAYYTMKMNLYNEMAVRIQRRWRGFRI 123

  Fly   139 RQYFQDFQGMKS-LR------------IQYVEDMLSSLYRKVHRMRKEHMLPGIYALRESDLLSK 190
            |:|..::..:|. ||            ::...:|.....|||...|:|....  |..|:...|..
Mouse   124 RKYCFNYYYLKEYLRAVSETNDAIREALEEFAEMKEREERKVLLEREEKQKD--YQARKMHYLLS 186

  Fly   191 IEDLSSTFG--YRFHNGRVRAAIAMKRSFINDRRHEFRKGNTYSKVP-----------YP----- 237
            .:.:|..:.  :|.|.......: .|...:..:::...||.| |:.|           :|     
Mouse   187 TKQISGIYNSPFREHPDPWELRL-QKAKPLGHQKYTAEKGKT-SQSPSNWLACTSVHSFPQSESL 249

  Fly   238 ---------GPYIENINDLEFTLPKRMTP--------------RLQRTILVYDKAMRDKNV-EKV 278
                     ||:    .|:...|.:|..|              ||.|.....::.||  || :|:
Mouse   250 PPISRKRCQGPF----RDINEVLEQRYKPLEPTLRVAEPINHLRLAREAFKQEERMR--NVQDKM 308

  Fly   279 YMNYSTKRRMSMHVMRENMRNRFCKDFVKRLAKRNKTRNAQDRNIKYYLD-DLLTTADEYNCFCK 342
            ::.:|:..:...::...:..:.:..|     :...|...:||.. |:..| |..|....:..|.|
Mouse   309 FLPFSSYHKKEKYIPMIHSSSAYNSD-----SYGQKHFRSQDSK-KWISDKDFQTVLPSFQLFSK 367

  Fly   343  342
            Mouse   368  367



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847349
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXK
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.790

Return to query results.
Submit another query.