DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12448 and Spata17

DIOPT Version :9

Sequence 1:NP_723942.2 Gene:CG12448 / 34942 FlyBaseID:FBgn0028857 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_006250511.1 Gene:Spata17 / 498305 RGDID:1565282 Length:363 Species:Rattus norvegicus


Alignment Length:291 Identity:59/291 - (20%)
Similarity:104/291 - (35%) Gaps:81/291 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NAARTIQCHVRGFLARSTLKRQIDAATIISKWWRGFWVRHSKFSFMQQLLQQRIIQYHHDMATKI 129
            :||..||...||...|:.::......|||.||||.:..|......::.......:..:::||.:|
  Rat    34 DAAVAIQSWFRGCQVRAYIRHLNRVVTIIQKWWRSYLGRKYYQLIVEAAYYTMKMNLYNEMAVRI 98

  Fly   130 QALFRGWMTRQY------------------------FQDFQGMK-----SLRIQYVEDMLSSLYR 165
            |..:||:..|:|                        .::|..||     .:.::..|.......|
  Rat    99 QRRWRGFRIRKYCFNYYYLKEYLRAVSETNDAIREALEEFAEMKEREERKILLELEEKQKDYQAR 163

  Fly   166 KVHRMRKEHMLPGIY--ALRESD-----LLSKIEDLSSTFGYRF-----HNGRVRAAIAMKRSF- 217
            |.|.:.....:.|:|  ..||..     .|.|.:.|....|...     |:.....|....||| 
  Rat   164 KTHYLLSTKQISGVYNSPFREHPDPWEVRLQKAKPLEHRKGSAMKSKTAHSLSSWLACTSARSFP 228

  Fly   218 -------INDRRHEFRKGNTYSKVPYPGPYIENINDLEFTLPKRMTPRLQRTILV---------- 265
                   |:.:|.:             ||:    .|:...|.:|..| |:.|:.|          
  Rat   229 RSASLPPIDRKRCQ-------------GPF----RDINEVLEQRYKP-LEPTLRVSEPIDHLHVA 275

  Fly   266 ---YDKAMRDKNV-EKVYMNYSTKRRMSMHV 292
               :.:..|.:|| :|:::.:|:..:...::
  Rat   276 REAFKQEERMRNVQDKMFLPFSSYHKKETYI 306



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350902
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXK
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.