DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12448 and CG18063

DIOPT Version :9

Sequence 1:NP_723942.2 Gene:CG12448 / 34942 FlyBaseID:FBgn0028857 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001162988.1 Gene:CG18063 / 34943 FlyBaseID:FBgn0028856 Length:372 Species:Drosophila melanogaster


Alignment Length:274 Identity:90/274 - (32%)
Similarity:146/274 - (53%) Gaps:27/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SRLKLALLDYKQFNAARTIQCHVRGFLARSTLKRQIDAATIISKWWRGFWVRHSKFSFMQQLLQQ 116
            :|::..:||||||.||||||.::.|:|.|...::...:|.||.||||.|..:.:.....:..||.
  Fly    45 TRVQSVILDYKQFKAARTIQRYIHGWLVRENFRKLQKSAIIIQKWWRRFEAQKNLLYVAESALQS 109

  Fly   117 RIIQYHHDMATKIQALFRGWMTRQYFQDFQGMKSLRIQYVEDMLSSLYRKVHRMRKEHMLPGIYA 181
            .::.::...||.||.|:|||.:|::..|...:||::|...:|::.||...:|..:...||||||.
  Fly   110 AVLAHYDKSATLIQTLYRGWWSRKHIFDLTMLKSVQIMLAKDLIHSLVNYLHATKNSEMLPGIYT 174

  Fly   182 LRESDL-LSKIEDLSSTFGYRFHNGRVRAAIAMKR--SFINDRRHEFRKGNTYSKVPYPGPYIEN 243
            :|:|.: |..:|:|.:|||:||:|  ..|...||.  |.:...|..|...:.::.|||||     
  Fly   175 IRDSSICLETLEELMATFGFRFYN--ANACYKMKETLSMVAQSRKTFTATSYFTDVPYPG----- 232

  Fly   244 INDLEFTLPKR---MT-----PRLQRTILVY-----DKAMRDKNVEKVYMNYSTKRRMSMHVMRE 295
            .||..|..|::   ||     |.....|.::     ...|....:|:...|.:.:.|::|.:.|:
  Fly   233 FNDRGFCGPRQNSAMTLNAKDPEHYELIHIFLSGSRKIGMTTAKLEQKIANIAEENRLNMFIKRD 297

  Fly   296 NMRNRFCKDFVKRL 309
            |.:    |.|:||:
  Fly   298 NKK----KSFIKRI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12448NP_723942.2 None
CG18063NP_001162988.1 IQ 78..99 CDD:197470 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464968
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXK
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014388
OrthoInspector 1 1.000 - - otm47562
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.