DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12448 and spata17

DIOPT Version :9

Sequence 1:NP_723942.2 Gene:CG12448 / 34942 FlyBaseID:FBgn0028857 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_031757738.1 Gene:spata17 / 100490367 XenbaseID:XB-GENE-987841 Length:358 Species:Xenopus tropicalis


Alignment Length:223 Identity:59/223 - (26%)
Similarity:94/223 - (42%) Gaps:52/223 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KQFNAARTIQCHVRGFLARSTLKRQIDAATIISKWWRGFWVR---HSKFSFMQQLLQQRIIQYHH 123
            |::|||..||...||...|:.|:......|:|.|||||:..|   .||......:::   :.:::
 Frog    31 KEYNAAVAIQSWFRGCQVRAYLRYLHKMVTVIQKWWRGYVARKYFRSKVKTAYFIMK---MNFYN 92

  Fly   124 DMATKIQALFRGWMTRQYFQDFQGMKSLRIQYVEDMLSSLYRKVHRMRKEHMLPGIYALRESDLL 188
            :||.:||..:||:..|:|..::..:|    :|:|.:..    |.:.:|||              |
 Frog    93 EMAVRIQKRWRGYFVRKYVHNYYALK----RYLEGVAI----KNNIVRKE--------------L 135

  Fly   189 SKIEDLSSTFGYRFHNGRVRAAIAMKRSFINDRR----HEFRKGNTYSKVPYPGPYIENINDLEF 249
            .|..|:.|         |.:|    |:...|:.|    |..:.....|....||.|    |....
 Frog   136 DKYADIKS---------REQA----KKKMENEEREKEYHARKMHYLLSTEQVPGIY----NSPYR 183

  Fly   250 TLPKRMTPRLQRTILVYDKAMRDKNVEK 277
            ..|..|..|||:...:..|   |:.:||
 Frog   184 PFPDSMEIRLQKARPLSHK---DRPMEK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12448NP_723942.2 None
spata17XP_031757738.1 IQ 55..76 CDD:197470 8/20 (40%)
COG5022 <74..>136 CDD:227355 17/86 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47562
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.