DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and prss60.1

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:280 Identity:84/280 - (30%)
Similarity:130/280 - (46%) Gaps:41/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VQADNQPLPTECGHV---NRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLG---GGSLITR 133
            ||..:..| ..||..   |||..|   .||.|    |..||.|:|   .|.:..|   |||||..
Zfish    15 VQGSHSQL-NVCGLAPLNNRIVGG---VNAFD----GSWPWQVSL---HSPIYGGHFCGGSLINS 68

  Fly   134 DVVLTSSTKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLA 198
            :.|||::.....:....|:|..|:...:.:.....:..|::  |..|.:.:.....|:.|||.|:
Zfish    69 EWVLTAAHCLPRITTSSLLVFLGKTTQQGVNTYEINRTVSV--ITVHPSYNNLTNENDIALLHLS 131

  Fly   199 RPLKLDHHIGLICLPPPNRNFIHNRCI-VSGWGK-KTALDNSYMNILKKIELPLVDRSVCQTKLQ 261
            ..:...::|..:||...|..|.:.... ::|||. :..::.....||::..:|:|....|...| 
Zfish   132 SAVTFSNYIRPVCLAAQNSVFPNGTSSWITGWGNIQLGVNLPAPGILQETMIPVVPNDQCNALL- 195

  Fly   262 GPYGKDFILDNSLICAG-GEPGKDTCKGDGGAPLACP-----LQSDPNRYELLGIVNFGFGCGGP 320
               |...: .|::|||| .:.|:|||:||.|.|:...     :||        ||.::|:||..|
Zfish   196 ---GSGSV-TNNMICAGLLQGGRDTCQGDSGGPMVSKQCLVWVQS--------GITSWGYGCADP 248

  Fly   321 L-PAAYTDVSQIRSWIDNCI 339
            . |..||.|||.:|||::.|
Zfish   249 YSPGVYTRVSQYQSWINSII 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 71/243 (29%)
Tryp_SPc 105..335 CDD:214473 69/241 (29%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 75/255 (29%)
Tryp_SPc 34..267 CDD:238113 76/257 (30%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587625
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.