DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:249 Identity:72/249 - (28%)
Similarity:119/249 - (47%) Gaps:33/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKYLIVR 154
            ::|..|:|       ..|..:|:.|:|.|..|.  ..|||||:...||:::    ...::.|.||
Mouse    22 DKIVGGYT-------CPKHSVPYQVSLNDGISH--QCGGSLISDQWVLSAA----HCYKRRLQVR 73

  Fly   155 AGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNF 219
            .||.:.:.:  |...:.:...||:||.:.:.:...|:..|:.|..|..|:..:..:.||....: 
Mouse    74 LGEHNIDVL--EGGEQFIDAEKIIRHPDYNKDTVDNDIMLIKLKSPAILNSQVSTVSLPRSCAS- 135

  Fly   220 IHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGG-EPGK 283
            .:.:|:|||||...::...|..:|:.:|.|::..|.|:....|.      :.:::.|.|. |.||
Mouse   136 TNAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQ------ITSNMFCLGFLEGGK 194

  Fly   284 DTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCG--GPLPAAYTDVSQIRSWI 335
            |:|.||.|.|:.|       ..|:.|||::|..|.  |. |..||.|....|||
Mouse   195 DSCDGDSGGPVVC-------NGEIQGIVSWGSVCAMRGK-PGVYTKVCNYLSWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 69/234 (29%)
Tryp_SPc 105..335 CDD:214473 67/232 (29%)
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 70/246 (28%)
Tryp_SPc 24..243 CDD:238113 72/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.