DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Prss44

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:350 Identity:92/350 - (26%)
Similarity:141/350 - (40%) Gaps:91/350 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GTETGRPIIDFRGL-NNGNQGCESGQTCCPKTEILQYP--------------------VQADNQP 81
            ||.:..|:....|| ::|....|...|..|:|.:.:.|                    :....||
Mouse    30 GTPSLSPLPSENGLDDSGVNPQERPLTGMPETSLPRKPGDSTRPLDSMAFTPGQSFSTMSLSRQP 94

  Fly    82 LPT------ECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTS- 139
            .||      .|||.....||.....||      :.||.|:|...:..  :.|||||::..|:|: 
Mouse    95 FPTWVPPTSACGHRTARIVGGRPAPAR------KWPWQVSLQVHKQH--ICGGSLISKWWVITAA 151

  Fly   140 -------------------STKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSV 185
                               |.:.:.:|.:.:||               |:|.::.:.|.|     
Mouse   152 HCVYGHLDYAVFMGDADLWSKRPVRIPVQDIIV---------------HQDFSMMRTVVH----- 196

  Fly   186 ENGANNAALLFLARPLKLDHHIGLICLPPPNRNFI---HNRCIVSGWGKKTALDNSYMNILKKIE 247
                 :.||:.||.|:....:|..:|:  |.::|:   ...|.|:||||......| ..||::||
Mouse   197 -----DIALVLLAFPVNYSVNIQPVCI--PEKSFLVQPGTLCWVTGWGKVLEQGRS-SRILQEIE 253

  Fly   248 LPLVDRSVCQTKLQGPYGKDF-ILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIV 311
            |.::....|...|:...|..| ::....:|...|.|.|.|:||.|.||.|...   ..:..:|||
Mouse   254 LNIIRHEKCNQILKDIMGNIFTLVQEGGVCGYNEKGGDACQGDSGGPLVCEFN---KTWVQVGIV 315

  Fly   312 NFGFGCGG-PLPAAYTDVSQIRSWI 335
            ::|.|||. ..|..||:||..|.||
Mouse   316 SWGLGCGRIGYPGVYTEVSYYRDWI 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 69/255 (27%)
Tryp_SPc 105..335 CDD:214473 68/254 (27%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72 10/40 (25%)
Tryp_SPc 111..340 CDD:214473 72/267 (27%)
Tryp_SPc 112..340 CDD:238113 72/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.