DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and TPSAB1

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:309 Identity:84/309 - (27%)
Similarity:135/309 - (43%) Gaps:70/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ILQYPVQADN---QPLPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLP----LGG 127
            :|..||.|..   .|.|.:.  :.|:|    |...:: |.:.:.||.|:|   |...|    ..|
Human     6 LLALPVLASRAYAAPAPGQA--LQRVG----IVGGQE-APRSKWPWQVSL---RVHGPYWMHFCG 60

  Fly   128 GSLITRDVVLTSS------TKTL-----EVPEKYLIVRAGEWDFESITEERAHED--VAIRKIVR 179
            ||||....|||::      .|.|     ::.|::|.                ::|  :.:.:|:.
Human    61 GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLY----------------YQDQLLPVSRIIV 109

  Fly   180 HTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNR-CIVSGWGKKTALDNSYM--- 240
            |..........:.|||.|..|:.:..|:..:.|||.:..|.... |.|:|||.   :||...   
Human   110 HPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGD---VDNDERLPP 171

  Fly   241 -NILKKIELPLVDRSVCQTKLQ-GPY-GKDF-ILDNSLICAGGEPGKDTCKGDGGAPLACPLQSD 301
             ..||::::|:::..:|..|.. |.| |.|. |:.:.::|| |...:|:|:||.|.||.|.:.  
Human   172 PFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCA-GNTRRDSCQGDSGGPLVCKVN-- 233

  Fly   302 PNRYELLGIVNFGFGCGGP-LPAAYTDVSQIRSWIDNCIQAEAVHYSPQ 349
             ..:...|:|::|.||..| .|..||.|:....||.        ||.|:
Human   234 -GTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIH--------HYVPK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 72/257 (28%)
Tryp_SPc 105..335 CDD:214473 70/255 (27%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 72/263 (27%)
Tryp_SPc 31..267 CDD:214473 71/262 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152841
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.