DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Prss55

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:273 Identity:80/273 - (29%)
Similarity:125/273 - (45%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 TECG----HVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSS--TK 142
            :|||    :.:||.....|....  |:.||.||.|::.:|...  ..|||:::...:||.:  ..
Mouse    44 SECGVRPLYDSRIQYSRIIEGQE--AELGEFPWQVSIQESDHH--FCGGSILSEWWILTVAHCFY 104

  Fly   143 TLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHI 207
            ..|:....|.||.|..|..:...|     :.:..|:||......|..|:.|||.||:||..:...
Mouse   105 AQELSPTDLRVRVGTNDLTTSPVE-----LEVTTIIRHKGFKRLNMDNDIALLLLAKPLTFNELT 164

  Fly   208 GLICLP----PPNRNFIHNRCIVSGWGKKTALDNSYMNI-LKKIELPLVDRSVCQTKLQGPYGKD 267
            ..||||    ||:    .:.|.|:|||...:.|...|:. |.|:.:.:::...|......     
Mouse   165 VPICLPLWPAPPS----WHECWVAGWGVTNSTDKESMSTDLMKVPMRIIEWEECLQMFPS----- 220

  Fly   268 FILDNSLICAG-GEPGKDTCKGDGGAPLACPLQSDP-NRYELLGIVNFGFGCGGP-LPAAYTDVS 329
              |..:::||. |....|.|:||.|.||.|  .:|| :|:..:||:::|..||.. .|..||.::
Mouse   221 --LTTNMLCASYGNESYDACQGDSGGPLVC--TTDPGSRWYQVGIISWGKSCGKKGFPGIYTVLA 281

  Fly   330 QIRSWIDNCIQAE 342
            :...||:...|.|
Mouse   282 KYTLWIEKIAQTE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 72/241 (30%)
Tryp_SPc 105..335 CDD:214473 70/239 (29%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 71/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.