DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Klk12

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:252 Identity:72/252 - (28%)
Similarity:106/252 - (42%) Gaps:64/252 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 KGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKYLIVRAGEWDFESI--TEERAH 169
            |...||.|.|.  ..:....||.|:.|..|||::    ...:|| :||.||.....:  ||:   
Mouse    30 KNSQPWQVGLF--HGKYLRCGGVLVDRKWVLTAA----HCRDKY-VVRLGEHSLTKLDWTEQ--- 84

  Fly   170 EDVAIRKIVRHTNLSV---------ENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNRCI 225
                    :|||..|:         :|..::..||.|.||:.|...:..:.||        :.|:
Mouse    85 --------LRHTTFSITHPSYQGAYQNHEHDLRLLRLNRPIHLTRAVRPVALP--------SSCV 133

  Fly   226 -------VSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGK 283
                   |||||......:.:.:.|:.:.|..|....|:....|.      :..:::|||||.||
Mouse   134 TTGAMCHVSGWGTTNKPWDPFPDRLQCLNLSTVSNETCRAVFPGR------VTENMLCAGGEAGK 192

  Fly   284 DTCKGDGGAPLAC--PLQSDPNRYELLGIVNFGF--GCGGP-LPAAYTDVSQIRSWI 335
            |.|:||.|.||.|  .||         |:|::|.  .||.. :|..||.|.:...||
Mouse   193 DACQGDSGGPLVCGGVLQ---------GLVSWGSVGPCGQKGIPGVYTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 72/252 (29%)
Tryp_SPc 105..335 CDD:214473 70/250 (28%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 70/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.