DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and TPSB2

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_077078.5 Gene:TPSB2 / 64499 HGNCID:14120 Length:275 Species:Homo sapiens


Alignment Length:306 Identity:83/306 - (27%)
Similarity:136/306 - (44%) Gaps:64/306 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ILQYPVQADN---QPLPTECGHVNRIGVGFTITNARDIAQKGELPWMVAL-LDSRSRLPLGGGSL 130
            :|..||.|..   .|.|.:.  :.|:|    |...:: |.:.:.||.|:| :..|..:...||||
Human     6 LLALPVLASRAYAAPAPGQA--LQRVG----IVGGQE-APRSKWPWQVSLRVRDRYWMHFCGGSL 63

  Fly   131 ITRDVVLTSS------TKTL-----EVPEKYLIVRAGEWDFESITEERAHED--VAIRKIVRHTN 182
            |....|||::      .|.|     ::.|::|.                ::|  :.:.:|:.|..
Human    64 IHPQWVLTAAHCVGPDVKDLAALRVQLREQHLY----------------YQDQLLPVSRIIVHPQ 112

  Fly   183 LSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNR-CIVSGWGKKTALDNSYM----NI 242
            ........:.|||.|..|:.:..|:..:.|||.:..|.... |.|:|||.   :||...    ..
Human   113 FYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGD---VDNDERLPPPFP 174

  Fly   243 LKKIELPLVDRSVCQTKLQ-GPY-GKDF-ILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNR 304
            ||::::|:::..:|..|.. |.| |.|. |:.:.::|| |...:|:|:||.|.||.|.:.   ..
Human   175 LKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCA-GNTRRDSCQGDSGGPLVCKVN---GT 235

  Fly   305 YELLGIVNFGFGCGGP-LPAAYTDVSQIRSWIDNCIQAEAVHYSPQ 349
            :...|:|::|.||..| .|..||.|:....||.        ||.|:
Human   236 WLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIH--------HYVPK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 71/254 (28%)
Tryp_SPc 105..335 CDD:214473 69/252 (27%)
TPSB2NP_077078.5 Tryp_SPc 31..268 CDD:238113 71/260 (27%)
Tryp_SPc 31..267 CDD:214473 70/259 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152842
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.