DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CELA2A

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_254275.1 Gene:CELA2A / 63036 HGNCID:24609 Length:269 Species:Homo sapiens


Alignment Length:278 Identity:89/278 - (32%)
Similarity:129/278 - (46%) Gaps:52/278 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLG------GGSLITRDVVLT--- 138
            ||...:|.|:..|       :.|:....||.|:|..|.:    |      |||||....|||   
Human    20 PTYPPYVTRVVGG-------EEARPNSWPWQVSLQYSSN----GKWYHTCGGSLIANSWVLTAAH 73

  Fly   139 --SSTKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHT--NLSVENGANNAALLFLAR 199
              ||::|         .|.|.........|.....|::.|||.|.  |.:..:..|:.|||.||.
Human    74 CISSSRT---------YRVGLGRHNLYVAESGSLAVSVSKIVVHKDWNSNQISKGNDIALLKLAN 129

  Fly   200 PLKLDHHIGLICLPP-----PNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTK 259
            |:.|...|.|.||||     || |:   .|.|:||| :...:.:..::|::..|.:||.:.|.:.
Human   130 PVSLTDKIQLACLPPAGTILPN-NY---PCYVTGWG-RLQTNGAVPDVLQQGRLLVVDYATCSSS 189

  Fly   260 LQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFG--FGCG-GPL 321
            ..  :|..  :..|:|||||:....:|.||.|.||.|  |:...|:::.|||:||  .||. ...
Human   190 AW--WGSS--VKTSMICAGGDGVISSCNGDSGGPLNC--QASDGRWQVHGIVSFGSRLGCNYYHK 248

  Fly   322 PAAYTDVSQIRSWIDNCI 339
            |:.:|.||....||::.|
Human   249 PSVFTRVSNYIDWINSVI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 83/252 (33%)
Tryp_SPc 105..335 CDD:214473 81/250 (32%)
CELA2ANP_254275.1 Tryp_SPc 29..265 CDD:238113 84/266 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.