DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG34458

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:238 Identity:63/238 - (26%)
Similarity:113/238 - (47%) Gaps:31/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 AQKGELPWMVAL-LDSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKYLIVRAGEWDFESITEERA 168
            |..|:.|..|:| |:.|...   |||||:..:::|::..|:......:....|..|..:...:..
  Fly    38 AAPGQFPHQVSLQLNGRHHC---GGSLISDTMIVTAAHCTMGQNPGQMKAIVGTNDLSAGNGQTF 99

  Fly   169 HEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNF-IHNRCIVSGWGKK 232
            :    |.:.:.|...:.::...:.:|:.|:.|:.:...:..|.|...:.|: .....::||:|  
  Fly   100 N----IAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQTIQLADSDSNYAADTMAMISGFG-- 158

  Fly   233 TALDNSYM--NILKKIELPLVDRSVCQTK-LQGPYGKDFILDNSLICAGGEPGK-DTCKGDGGAP 293
             |::.:..  |.||..::.|..|..|.:: :.|       |.:.::|||...|: .:|:||.|.|
  Fly   159 -AINQNLQLPNRLKFAQVQLWSRDYCNSQNIPG-------LTDRMVCAGHPSGQVSSCQGDSGGP 215

  Fly   294 LACPLQSDPNRYELLGIVNFGFGCGGP-LPAAYTDVSQIRSWI 335
            |...       .:|.|:|::|||||.. .||.||.|..:||||
  Fly   216 LTVD-------GKLFGVVSWGFGCGAKGRPAMYTYVGALRSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 63/238 (26%)
Tryp_SPc 105..335 CDD:214473 61/236 (26%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 61/236 (26%)
Tryp_SPc 32..254 CDD:238113 63/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.