DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Prss21

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_065233.2 Gene:Prss21 / 57256 MGIID:1916698 Length:324 Species:Mus musculus


Alignment Length:319 Identity:94/319 - (29%)
Similarity:144/319 - (45%) Gaps:65/319 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PKTEILQYPVQADNQPLPTECGH---VNRIGVGFTITNARDIAQKGELPWMVALLDSRSRL---P 124
            |:...||.|     ..|...|||   .:||..|       |.|:.|..||..:|     |:   .
Mouse    31 PEKPELQEP-----DLLSGPCGHRTIPSRIVGG-------DDAELGRWPWQGSL-----RVWGNH 78

  Fly   125 LGGGSLITRDVVLTSS----------TKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVR 179
            |.|.:|:.|..|||::          ..|::..|  |..|...|:.::.:.....||:.:..  :
Mouse    79 LCGATLLNRRWVLTAAHCFQKDNDPFDWTVQFGE--LTSRPSLWNLQAYSNRYQIEDIFLSP--K 139

  Fly   180 HTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNR--CIVSGWGKKTALDNSY--M 240
            ::    |...|:.|||.|:.|:..::.|..|||......| .||  |.|:||| ....|.|.  .
Mouse   140 YS----EQYPNDIALLKLSSPVTYNNFIQPICLLNSTYKF-ENRTDCWVTGWG-AIGEDESLPSP 198

  Fly   241 NILKKIELPLVDRSVCQTKLQGPYGKDFILD--NSLICAG-GEPGKDTCKGDGGAPLACPLQSDP 302
            |.|:::::.:::.|:|....:.|   ||..:  ..::||| .|.|||.|.||.|.||||  ..|.
Mouse   199 NTLQEVQVAIINNSMCNHMYKKP---DFRTNIWGDMVCAGTPEGGKDACFGDSGGPLAC--DQDT 258

  Fly   303 NRYELLGIVNFGFGCGGP-LPAAYTDVSQIRSWIDNCIQAEAVHYSPQLGNVGQSPAPL 360
            ..|: :|:|::|.|||.| .|..||::|...:||.:.:...        |.:...|.||
Mouse   259 VWYQ-VGVVSWGIGCGRPNRPGVYTNISHHYNWIQSTMIRN--------GLLRPDPVPL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 78/252 (31%)
Tryp_SPc 105..335 CDD:214473 76/250 (30%)
Prss21NP_065233.2 Tryp_SPc 54..291 CDD:214473 80/264 (30%)
Tryp_SPc 55..294 CDD:238113 81/266 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.