DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and tmprss5

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:313 Identity:86/313 - (27%)
Similarity:136/313 - (43%) Gaps:67/313 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FRGLNNGNQGCESGQTCCPKTEILQYPVQADNQPLPTECG---HVNRIGVGFTITNARDIAQKGE 109
            |||      .|.:|:....|.               .|||   .:.||..|..       |..|.
Zfish   286 FRG------SCSTGKVIALKC---------------FECGTRAKLPRIIGGVE-------AALGR 322

  Fly   110 LPWMVALLDSRSRLPLGGGSLITRDVVLTS-----STKTLEVPEKYLIVRAGEWDFESITEERA- 168
            .||.|:|..:...  :.|||:||...::|:     :.:..:||.  .:|.||     .||...| 
Zfish   323 WPWQVSLYYNNRH--ICGGSIITNQWIVTAAHCVHNYRLPQVPS--WVVYAG-----IITSNLAK 378

  Fly   169 ---HEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIHN-----RCI 225
               ::..|:.:|:.:.|.:.....|:.||:.|..||.....|..:|||    .:.|:     :|.
Zfish   379 LAQYQGFAVERIIYNKNYNHRTHDNDIALVKLKTPLNFSDTIRPVCLP----QYDHDLPGGTQCW 439

  Fly   226 VSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGK-DTCKGD 289
            :||||.....|.....:||:..:||:....|.:...  |..:  :.:.::|||...|| |.|:||
Zfish   440 ISGWGYTQPDDVLIPEVLKEAPVPLISTKKCNSSCM--YNGE--ITSRMLCAGYSEGKVDACQGD 500

  Fly   290 GGAPLACPLQSDPNRYELLGIVNFGFGCGGP-LPAAYTDVSQIRSWIDNCIQA 341
            .|.||.|   .|.|.:.|:|:|::|.||..| .|..|:.|::...||.:.|::
Zfish   501 SGGPLVC---QDENVWRLVGVVSWGTGCAEPNHPGVYSKVAEFLGWIYDIIES 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 73/247 (30%)
Tryp_SPc 105..335 CDD:214473 71/245 (29%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133 9/40 (23%)
Tryp_SPc 311..544 CDD:214473 74/259 (29%)
Tryp_SPc 312..547 CDD:238113 75/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.