DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and tmprss13b

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_005165399.1 Gene:tmprss13b / 564693 ZFINID:ZDB-GENE-090309-2 Length:475 Species:Danio rerio


Alignment Length:312 Identity:79/312 - (25%)
Similarity:137/312 - (43%) Gaps:54/312 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FRGLN----NGNQGCESGQTCCPKTEILQYPVQADNQPLPTECGHVNRIGVGFTITNARDIAQKG 108
            |:.:|    |..||..:..:.||           |.|.:..:|....|..|...|... .:|.:|
Zfish   195 FQSVNSQLVNNIQGRVNTSSSCP-----------DQQSVSLQCCDCGRPPVSSRIIGG-SVAAEG 247

  Fly   109 ELPWMVAL-LDSRSRLPLGGGSLITRDVVLTSS------TKTLEVPEKYLIVRAGEWDFESITEE 166
            ..||..:| ...:...   ||||:..|.::|::      |...::|..:.:.      ...:::.
Zfish   248 HWPWQASLHFQGKHSC---GGSLVAPDFIITAAHCFPKETSGSQLPSNWKVY------IGFVSQL 303

  Fly   167 RAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLP------PPNRNFIHNRCI 225
            :......:::|:.|...:......:.|||.|.:|..   .:..||||      ||.:     :|.
Zfish   304 KLPSPYYVKEIILHEKYNPTTKNYDIALLKLNKPAS---DVEPICLPVIGQTFPPAK-----QCW 360

  Fly   226 VSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGG-EPGKDTCKGD 289
            .:|:|......||....|.::.:.|:|.|||.:    |...:..:..::.|||. ..|||:|:||
Zfish   361 TTGFGVIRQGSNSVSTSLMEVTVSLIDSSVCNS----PNVYNGEITENMQCAGDLRGGKDSCQGD 421

  Fly   290 GGAPLACPLQSDPNRYELLGIVNFGFGCGG-PLPAAYTDVSQIRSWIDNCIQ 340
            .|.||||  :|:..::.|.|:.::|.|||. ..|..|:||::...||.:.:|
Zfish   422 SGGPLAC--KSNDGQWFLTGVTSWGEGCGQVNRPGVYSDVAKYLMWIYSKMQ 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 65/246 (26%)
Tryp_SPc 105..335 CDD:214473 63/244 (26%)
tmprss13bXP_005165399.1 SRCR_2 147..230 CDD:295335 10/45 (22%)
Tryp_SPc 237..466 CDD:214473 64/252 (25%)
Tryp_SPc 238..469 CDD:238113 66/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.