DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and PRSS3

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:285 Identity:76/285 - (26%)
Similarity:127/285 - (44%) Gaps:56/285 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ADNQPLPTECGHVNRIGV------------GFTITNARDIAQKGELPWMVALLDSRSRLPLGGGS 129
            :|..|:..:    |.:||            |:|       .::..||:.|:|   .|.....|||
Human    87 SDYLPIRNQ----NELGVAVPFDDDDKIVGGYT-------CEENSLPYQVSL---NSGSHFCGGS 137

  Fly   130 LITRDVVLTSS--TKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNA 192
            ||:...|::::  .||      .:.||.||.:.:.:  |...:.:...||:||...:.:...|:.
Human   138 LISEQWVVSAAHCYKT------RIQVRLGEHNIKVL--EGNEQFINAAKIIRHPKYNRDTLDNDI 194

  Fly   193 ALLFLARPLKLDHHIGLICLP--PPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSV 255
            .|:.|:.|..::..:..|.||  ||...   ..|::||||...:....|.:.||.::.|::.::.
Human   195 MLIKLSSPAVINARVSTISLPTTPPAAG---TECLISGWGNTLSFGADYPDELKCLDAPVLTQAE 256

  Fly   256 CQTKLQGPYGKDFILDNSLICAGG-EPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGG 319
            |:....|.      :.||:.|.|. |.|||:|:.|.|.|:.|       ..:|.|:|::|.||..
Human   257 CKASYPGK------ITNSMFCVGFLEGGKDSCQRDSGGPVVC-------NGQLQGVVSWGHGCAW 308

  Fly   320 P-LPAAYTDVSQIRSWIDNCIQAEA 343
            . .|..||.|.....||.:.|.|.:
Human   309 KNRPGVYTKVYNYVDWIKDTIAANS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 67/237 (28%)
Tryp_SPc 105..335 CDD:214473 65/235 (28%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 67/249 (27%)
Tryp_SPc 110..328 CDD:238113 69/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.