DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and zgc:112038

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:245 Identity:77/245 - (31%)
Similarity:121/245 - (49%) Gaps:26/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 NARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSS-----TKTLEVPEKYLIVRAGEWD 159
            |..|.|..|..||..::........:.|||||.:|.||:::     |.|..:  |..:.|    .
Zfish    36 NGGDDAVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAHCFMITATANI--KIFLGR----Q 94

  Fly   160 FESITEERAHE-DVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFI-HN 222
            |:  |....:| ...:.:||.|.:.|.....|:.|||.|:..:....:|..:||...:..|. ..
Zfish    95 FQ--TGSNPNEISRTLTQIVIHPDYSTTTQNNDIALLRLSSSVTFTDYIRPVCLASADSVFAGGT 157

  Fly   223 RCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAG-GEPGKDTC 286
            :..::||.|..:.|....|:|::::||:|..:.|....:|      |:.:::|||| .|.|||.|
Zfish   158 KSWITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNADYKG------IITDNMICAGINEGGKDAC 216

  Fly   287 KGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGP-LPAAYTDVSQIRSWI 335
            :||.|.|:   :..:.:|:...|||:||..||.| .|..||.|||.:|||
Zfish   217 QGDSGGPM---VSQNGSRWIQSGIVSFGRECGLPRYPGIYTRVSQYQSWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 75/240 (31%)
Tryp_SPc 105..335 CDD:214473 73/238 (31%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 74/242 (31%)
Tryp_SPc 37..263 CDD:238113 74/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.