DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and prss60.2

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:265 Identity:80/265 - (30%)
Similarity:130/265 - (49%) Gaps:25/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 GHVNRIGV-GFTITNARDI----AQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLEV 146
            |.::::.| |....|:|.:    |.:|..||.|:|...|......|||||:.:.|||::.....|
Zfish    17 GSLSQLNVCGQAPLNSRIVGGVNAPEGSWPWQVSLQSPRYGGHFCGGSLISSEWVLTAAHCLPGV 81

  Fly   147 PEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLIC 211
            .|..|:|..|....:.:.......:||  ||:.|::.:.....|:.|||.|:..:..:.:|..:|
Zfish    82 SESSLVVYLGRRTQQGVNTHETSRNVA--KIIVHSSYNSNTNDNDIALLRLSSAVTFNDYIRPVC 144

  Fly   212 LPPPNRNF-IHNRCIVSGWGK-KTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSL 274
            |...|..: ......::|||. :..::.....||::..:|:|....|..:|    |...: .|::
Zfish   145 LAAQNSVYSAGTSSWITGWGDVQAGVNLPAPGILQETMIPVVANDRCNAQL----GSGTV-TNNM 204

  Fly   275 ICAG-GEPGKDTCKGDGGAPLA---CPLQSDPNRYELLGIVNFGFGCGGP-LPAAYTDVSQIRSW 334
            |||| .:.|||||:||.|.|:.   |.:      :...||.::|:||..| .|..||.|||.:||
Zfish   205 ICAGLAKGGKDTCQGDSGGPMVTRLCTV------WIQAGITSWGYGCADPNSPGVYTRVSQYQSW 263

  Fly   335 IDNCI 339
            |.:.|
Zfish   264 ISSKI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 74/238 (31%)
Tryp_SPc 105..335 CDD:214473 72/236 (31%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 73/243 (30%)
Tryp_SPc 34..267 CDD:238113 74/245 (30%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587623
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.