DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and sdhaf4

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001008179.1 Gene:sdhaf4 / 493541 XenbaseID:XB-GENE-1007482 Length:118 Species:Xenopus tropicalis


Alignment Length:108 Identity:26/108 - (24%)
Similarity:41/108 - (37%) Gaps:28/108 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 HNRCIVSG-WGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKD 284
            ||..:.|| |....||.::..:.:|..:.||       .|...|.||   .|:|        .:.
 Frog    28 HNLKMWSGLWNSCRALSHNSQHNIKGTKQPL-------KKPTTPQGK---FDDS--------EQT 74

  Fly   285 TCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGPLPAAYTD 327
            |.:.:       ||:..|:  ::..:.....|..||.|..|.|
 Frog    75 TLEKN-------PLEKFPD--DINPVTKEKGGPRGPEPTRYGD 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 26/108 (24%)
Tryp_SPc 105..335 CDD:214473 26/108 (24%)
sdhaf4NP_001008179.1 DUF1674 76..118 CDD:311723 9/42 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.