DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001025468.1 Gene:Tmprss11c / 435845 MGIID:3521861 Length:431 Species:Mus musculus


Alignment Length:360 Identity:92/360 - (25%)
Similarity:158/360 - (43%) Gaps:68/360 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SRIQALFCGGSMAKECVQRNRCRIGTETGRPII----DFRGL--NNGNQGCES----------GQ 62
            |.:...|....:.|:.|:.:..::....|:.:|    .|:..  ||..:..||          ||
Mouse    96 SLMNETFHESKLRKQYVKAHTVQVSKAKGKVVIHAVLKFKACYRNNVEKYWESVETTLYQKLKGQ 160

  Fly    63 T------CCPKTEILQYPVQADNQPLPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRS 121
            |      ...|...:..|:..|  .|.|.||....|..|..:...:| |::||.||..:|  .::
Mouse   161 TGLLIDSSSFKFSDIAMPIAED--LLNTCCGRRTIIHRGHKVAGGQD-AEEGEWPWQASL--QQN 220

  Fly   122 RLPLGGGSLITRDVVLTSSTKTLEVPEKYLIVRAG---EWDFE---SITEERAHEDVAIRKIVRH 180
            .:...|.:||:...::|::         :..:||.   :|...   .:::.:|..  |::.|:.|
Mouse   221 SVHRCGATLISNYWLITAA---------HCFIRAANPKDWKVSFGFLLSKPQAPR--AVKNIIIH 274

  Fly   181 TNLSVENGANNAALLFLARPLKLDHHIGLICLP------PPNRNFIHNRCIVSGWGKKTALDNSY 239
            .|.|.....|:.|::.|:.|:..:.:|...|||      |||.:     .:|:|||...: |...
Mouse   275 ENYSYPAHDNDIAVVRLSSPVLYESNIRRACLPEATQKFPPNSD-----VVVTGWGTLKS-DGDS 333

  Fly   240 MNILKKIELPLVDRSVCQTKLQGPYGKDF--ILDNSLICAGGEPGK-DTCKGDGGAPLACPLQSD 301
            .|||:|.::.::|...|.:      ||.:  ::...::|||...|: |.|:||.|.||..  :..
Mouse   334 PNILQKGKVKIIDNKTCNS------GKAYGGMITPGMMCAGFLKGRVDACQGDSGGPLVS--EDS 390

  Fly   302 PNRYELLGIVNFGFGCGGP-LPAAYTDVSQIRSWI 335
            ...:.|.|||::|..|..| .|..||.|:..|.||
Mouse   391 KGIWFLAGIVSWGDECALPNKPGVYTRVTYYRDWI 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 68/247 (28%)
Tryp_SPc 105..335 CDD:214473 66/245 (27%)
Tmprss11cNP_001025468.1 SEA 62..157 CDD:279699 11/60 (18%)
Tryp_SPc 199..425 CDD:214473 67/253 (26%)
Tryp_SPc 200..428 CDD:238113 69/254 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.