DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG7142

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:322 Identity:80/322 - (24%)
Similarity:125/322 - (38%) Gaps:80/322 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LPT--ECGHVNRIGVGFTITNARDIAQKG---------ELP----WMVALLDSRSRLPLG----- 126
            |||  :||.....|...|:  |.::|..|         |.|    |....|..|...|..     
  Fly    33 LPTVRKCGGGRSAGAAHTM--AMNLAAYGLLENRISTLEAPRQTHWTKKFLAKREATPHSAPYVV 95

  Fly   127 ---------------GGSLITRDVVLTSSTKTLEVPE--KYLIVRAGEWDFESITEERAHEDVAI 174
                           .|::|....:||:: ..|..|:  :..::.||..|......|.:  ::.:
  Fly    96 SIQMMTPDQGLVHYCAGTIINEHWILTAA-HCLSSPQAVENSVIVAGSHDIHDQKGEAS--NIQM 157

  Fly   175 RKI---VRHTNLSVENGAN--NAALLFLARPLKLDHHIGLICLP-----PPNRNFIHNRCIVSGW 229
            |.|   ||| .|.: .|.|  :.||::...||..|.::....||     |.....::      ||
  Fly   158 RHIDYYVRH-ELYL-GGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTLY------GW 214

  Fly   230 G--KKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEP---GKDTCKGD 289
            |  ..||:.| |.:.|::..:|::|..:|:..|.   .....|..:.:|.|  |   |...|..|
  Fly   215 GNVSMTAVPN-YPHRLQEANMPILDMELCEQILA---RSGLPLHETNLCTG--PLTGGVSICTAD 273

  Fly   290 GGAPLACPLQSDPNRYE----LLGIVNFG-FGCGGP-LPAAYTDVSQIRSWIDNCIQAEAVH 345
            .|.||.  .|.....:|    ::|||::| ..||.. .|:.:..||....||:..| :.|.|
  Fly   274 SGGPLI--QQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVI-STATH 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 69/287 (24%)
Tryp_SPc 105..335 CDD:214473 67/285 (24%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 63/260 (24%)
Tryp_SPc 84..323 CDD:214473 61/257 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.