DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG14892

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster


Alignment Length:400 Identity:90/400 - (22%)
Similarity:127/400 - (31%) Gaps:163/400 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 TECG-----HVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGG---GSLITRDVVLTSS 140
            |:||     ...||..| ..||      :|:.||..:|......|...|   |:::.....:.|:
  Fly    68 TDCGCRPARRGPRIIAG-AATN------EGQFPWQASLELLHPSLGFLGHWCGAVLIHQYWILSA 125

  Fly   141 TK-------TLEVPEKYLIVRAGEW--DFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLF 196
            ..       .|.:|..:.:| .||.  |.||..|:|    :.:.|||.|..  ..|..::..|:.
  Fly   126 AHCVHNDLFNLPIPPLWTVV-LGEHDRDVESGNEQR----IPVEKIVMHHR--YHNFKHDVVLMK 183

  Fly   197 LARPLKLDH--HIGLICLP----------------PPNR--------------------NFI--- 220
            |::|..|..  :|..||||                ||:.                    ||:   
  Fly   184 LSKPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSV 248

  Fly   221 -------------------------------------HNR------------------------- 223
                                                 |.|                         
  Fly   249 QSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKH 313

  Fly   224 --------------CIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSL 274
                          |:.:||||.. :.....|.|.|.::||.....|    :..||....:....
  Fly   314 PKVSDEPKEIAFVDCVATGWGKAN-ISGDLSNQLLKTQVPLHQNGRC----RDAYGSFVNIHGGH 373

  Fly   275 ICAG---GEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCG-GPLPAAYTDVSQIRSWI 335
            :|||   ||.|  ||.||.|.||.|.|..| ..:.|:|:.:||.||. ...|..||..|....||
  Fly   374 LCAGKLNGEGG--TCVGDSGGPLQCRLSRD-GPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWI 435

  Fly   336 DNCIQAEAVH 345
            ::.|   |.|
  Fly   436 EDTI---ATH 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 79/364 (22%)
Tryp_SPc 105..335 CDD:214473 77/362 (21%)
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 82/376 (22%)
Tryp_SPc 81..438 CDD:238113 83/378 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.