DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG9649

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:348 Identity:87/348 - (25%)
Similarity:141/348 - (40%) Gaps:64/348 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KECVQRNRCRIGTETGRPIIDFRGLNNGNQGCESGQTCCPKTEILQYP---------VQADNQP- 81
            :|.|||.|.:......||           |...|.....|..::.|.|         |...|.| 
  Fly   176 EEPVQRRRPQQRPSRPRP-----------QQAPSRPRLQPVPQLPQEPEFQTSARPSVHPSNTPA 229

  Fly    82 ------------LPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLD--SRSRLPLGGGSLIT 132
                        |...||....|...| |.|..:: ::|:||||.||.:  .|....|.||:||:
  Fly   230 QASKFYPQTIGQLSGICGREKVIQTPF-IHNGIEV-ERGQLPWMAALFEHVGRDYNFLCGGTLIS 292

  Fly   133 RDVVLTSS----TKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHT--NLSVENGANN 191
            ...|::::    ..:..:|.:..||..|.   .|:....:...:.:.:::.|.  |.:|...| :
  Fly   293 ARTVISAAHCFRFGSRNLPGERTIVSLGR---NSLDLFSSGATLGVARLLIHEQYNPNVYTDA-D 353

  Fly   192 AALLFLARPLKLDHHIGLICLPPPNRNFI-----HNRCIVSGWGKKTALDNSYMNILKKIELPLV 251
            .|||.|:..:.:..:|..|||  .|.||:     .::..|:|||:... .|....:.|..:..::
  Fly   354 LALLQLSNHVDIGDYIKPICL--WNENFLLELPSGHKSYVAGWGEDEK-GNRNTRLAKMTDTDII 415

  Fly   252 DRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFG-- 314
            .:..|:..|.....| ||..:: |||........|.||.|..|   :..:.:.:.|.|:|:.|  
  Fly   416 TQWECRGNLSEENAK-FITSHT-ICASNAQASGPCSGDSGGGL---MLQEQDIWMLRGVVSAGQR 475

  Fly   315 --FGCGGPLPAAYTDVSQIRSWI 335
              ..|...||..||||::...|:
  Fly   476 MTNRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 65/248 (26%)
Tryp_SPc 105..335 CDD:214473 64/246 (26%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 66/253 (26%)
Tryp_SPc 259..497 CDD:214473 65/250 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.