DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG3916

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:246 Identity:59/246 - (23%)
Similarity:102/246 - (41%) Gaps:35/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LPWMVAL-LDSRSRLP-LGGGSLITRDVVLTSS--TKTLEVPEKYLIVRAGEWDFESITEERAHE 170
            :|:.|:| :..|.|.. ..|||:::...|||::  .:.::|.:..::|....|....:..     
  Fly    41 VPFQVSLQMQRRGRWQHFCGGSIVSGQHVLTAAHCMEKMKVEDVSVVVGTLNWKAGGLRH----- 100

  Fly   171 DVAIRKIVRHTNLSVENG---ANNAALLFLARPLKLDH-HIGLICLPPPNRNFIHNRCIV--SGW 229
                |.:.:|.:......   .|:.||:.:..|.:|:. .|..|.:...:|  |..:..|  :||
  Fly   101 ----RLVTKHVHPQYSMNPRIINDIALVKVTPPFRLERSDISTILIGGSDR--IGEKVPVRLTGW 159

  Fly   230 GKKTALDNS--YMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGA 292
            |..:...:|  ..:.|:.:....:....|..       |.|.:..:.|||....|:..|.||.|.
  Fly   160 GSTSPSTSSATLPDQLQALNYRTISNEDCNQ-------KGFRVTRNEICALAVQGQGACVGDSGG 217

  Fly   293 PLACPLQSDPNRYELLGIVNFGFG-CGGPLPAAYTDVSQIRSWIDNCIQAE 342
            ||..| ...|:   |:|||::|.. |....|..||.||....:|...|..:
  Fly   218 PLIRP-GKQPH---LVGIVSYGSSTCAQGRPDVYTRVSSFLPYISQVINQD 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 58/239 (24%)
Tryp_SPc 105..335 CDD:214473 57/237 (24%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 57/237 (24%)
Tryp_SPc 31..260 CDD:238113 58/240 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.