DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG17404

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:269 Identity:76/269 - (28%)
Similarity:120/269 - (44%) Gaps:35/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 GHVN-RIGVGFT---ITNARDIAQKGELPWMVALLDSRSR---LPLGGGSLITRDVVLTSSTKTL 144
            |.:| |...|:|   |....||.....:|:.|: |..|:|   :...|||:|..:.:||::....
  Fly    20 GRLNSRQPSGYTPHRIVGGADIPPGEHVPYQVS-LQYRTRGGQMHFCGGSIIAPNRILTAAHCCQ 83

  Fly   145 EVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHH-IG 208
            .:....:.|.||   ...:.|:.:...|....|  |.... |...::.|:|.:..||||::. |.
  Fly    84 GLNASRMSVVAG---IRGLNEKGSRSQVLSYSI--HPKYQ-ELVTSDLAVLSIKPPLKLNNSTIS 142

  Fly   209 LICLPPPNRNFIHNRCIV--SGWGKKTA-----LDN-SYMNILKKIELPLVDRSVCQTKLQGPYG 265
            .|......::|:.....|  :|||.:..     ||| :|.|:|:::....:..|.|:..     |
  Fly   143 AIEYRSQGKDFVGGGVPVTLTGWGLRLPVPFPFLDNVNYPNVLQRMSYHTISNSECRNA-----G 202

  Fly   266 KDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGF-GCGGPL-PAAYTDV 328
            .:.:.|.. |||.| |.:..|.||.|.||   :....|..:.:|||::|. .||..: |..||.|
  Fly   203 MESVTDTE-ICARG-PFRGACSGDSGGPL---VMESKNGLQQVGIVSYGLVVCGLYISPDVYTRV 262

  Fly   329 SQIRSWIDN 337
            |....||.|
  Fly   263 STFSDWIGN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 67/245 (27%)
Tryp_SPc 105..335 CDD:214473 65/243 (27%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 68/251 (27%)
Tryp_SPc 35..269 CDD:238113 68/250 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.