DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Sp7

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:287 Identity:87/287 - (30%)
Similarity:130/287 - (45%) Gaps:46/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PLPTECG-HVNRIGVGFT--ITNARDIAQKGELPWMVAL--LDSRSRLPLG-GGSLITRDVVLTS 139
            |.|.:|| |      .|:  :.|..|.| ..|..||..|  :|:|.|..|. |||||....|||:
  Fly   123 PSPPKCGPH------SFSNKVYNGNDTA-IDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTA 180

  Fly   140 STKTLEVPEKYL----IVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVE-------------N 187
            :...:...|..:    .||.||:|.....:  ..:|:..:.|::   |.:|             |
  Fly   181 AHCVIGAVETEVGHLTTVRLGEYDTSKDVD--CIDDICNQPILQ---LGIEQATVHPQYDPANKN 240

  Fly   188 GANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNR---CIVSGWGKKTALDNSYMNILKKIELP 249
            ..::.|||.|.||:.|:.:|..:|||..:.....|.   .:|||||:.|....|  .|.::::||
  Fly   241 RIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTTTARKS--TIKQRLDLP 303

  Fly   250 LVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFG 314
            :.|...|..|..   .::..|.:|.:|.|||..:|:|.||.|.||.  .:.....:...|:|:||
  Fly   304 VNDHDYCARKFA---TRNIHLISSQLCVGGEFYRDSCDGDSGGPLM--RRGFDQAWYQEGVVSFG 363

  Fly   315 FGCG-GPLPAAYTDVSQIRSWIDNCIQ 340
            ..|| ...|..||.|:....||...|:
  Fly   364 NRCGLEGWPGVYTRVADYMDWIVETIR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 78/255 (31%)
Tryp_SPc 105..335 CDD:214473 76/253 (30%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 78/261 (30%)
Tryp_SPc 137..388 CDD:238113 80/263 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.