DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Try10

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:258 Identity:76/258 - (29%)
Similarity:125/258 - (48%) Gaps:40/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKYLIVR 154
            ::|..|:|       .|:..:|:.|:|   .|.....|||||....|::::    ...:..:.||
  Rat    22 DKIVGGYT-------CQENSVPYQVSL---NSGYHFCGGSLINEQWVVSAA----HCYKSRIQVR 72

  Fly   155 AGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLP----PP 215
            .||.:...:  |...:.|...||::|.|...:...|:..|:.|:.|:||:..:..:.||    |.
  Rat    73 LGEHNINVL--EGNEQFVNAAKIIKHPNFIRKTLNNDIMLIKLSSPVKLNSRVATVALPSSCAPA 135

  Fly   216 NRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGG- 279
            .     .:|::||||...:...:..::|:.::.||:.::.|:....|.     |.|| ::|||. 
  Rat   136 G-----TQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCEASYPGK-----ITDN-MVCAGFL 189

  Fly   280 EPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGP-LPAAYTDVSQIRSWIDNCIQA 341
            |.|||:|:||.|.|:.|       ..||.|||::|:||..| .|..||.|.....||.:.|.|
  Rat   190 EGGKDSCQGDSGGPVVC-------NGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 71/237 (30%)
Tryp_SPc 105..335 CDD:214473 69/235 (29%)
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 72/249 (29%)
Tryp_SPc 24..242 CDD:238113 74/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.