DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Prss46

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_006244055.1 Gene:Prss46 / 408245 RGDID:1302970 Length:314 Species:Rattus norvegicus


Alignment Length:269 Identity:73/269 - (27%)
Similarity:121/269 - (44%) Gaps:46/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 CGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLG----GGSLITRDVVLTSS--TKTL 144
            ||..|   :...:.|.: :.:.|:.||.|::|.      ||    .||||....|||::  .:..
  Rat    35 CGQTN---ISCKVVNGK-VVEVGKWPWQVSILF------LGMYICSGSLIHHHWVLTAAHCLQRS 89

  Fly   145 EVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGL 209
            :.|..| .|:.|   .:::.:..:.| :.:..||.|.|. :.:.:::.|:|.|..|:.....|..
  Rat    90 KNPANY-TVKVG---VQTLPDNSSSE-LLVTSIVIHENF-INHMSHDIAILKLKYPVTWSPFIQP 148

  Fly   210 ICLPPPN-RNFIHNRCIVSGWG---KKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFIL 270
            ||||..| :..|...|.|.|||   .|.|....|.  ::.:.:.:|:..:|..:.|      |:|
  Rat   149 ICLPEVNFKPSIGTMCWVIGWGLEKAKGAPKTPYS--VQGVAVRIVNNEICNHRYQ------FLL 205

  Fly   271 --------DNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCG-GPLPAAYT 326
                    .|.::|...|.|.|||:...|:.|.|.:.   ..:..:|:|::.|||| ...|:.||
  Rat   206 LKNQKKFIGNDMLCTSPEWGLDTCQDASGSSLVCQMN---KTWIQMGVVSWNFGCGRRQFPSIYT 267

  Fly   327 DVSQIRSWI 335
            ..|....||
  Rat   268 STSHFTQWI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 69/250 (28%)
Tryp_SPc 105..335 CDD:214473 67/248 (27%)
Prss46XP_006244055.1 Tryp_SPc 43..276 CDD:214473 68/256 (27%)
Tryp_SPc 44..279 CDD:238113 70/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.