DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG11037

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:301 Identity:79/301 - (26%)
Similarity:131/301 - (43%) Gaps:65/301 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ESGQTCCPKTEILQYPVQADNQPLPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRL 123
            ||||   |...:.....|.....||:.  |..|:..|...|||:    .|  .::.|||..... 
  Fly    34 ESGQ---PGKNLTLDVAQLAKIVLPSP--HETRVIGGHVTTNAK----LG--GYLTALLYEDDF- 86

  Fly   124 PLGGGSLITRDVVLTSSTKTLEVPEKYLIVRAGEW----DFESITEE--RAH-EDVAIRKIVRHT 181
             :.||:|:..::|||::...|.      .::|.||    ...::.::  |.| :|..:.:..|..
  Fly    87 -VCGGTLLNENIVLTAAHCFLG------RMKASEWIVAAGISNLNQKGIRRHVKDFILSEQFRED 144

  Fly   182 NLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNFIHNRC----------IVSGWGKKTALD 236
            :::::     .|::.|..|||. .:||.:.|           |          :|||||......
  Fly   145 DMNMD-----VAVVLLKTPLKA-KNIGTLSL-----------CSVSLKPGVELVVSGWGMTAPRG 192

  Fly   237 NSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSD 301
            ....|:|:.:.:|::.:..|:...| |..|   :.:|:|||.....||.|..|.|.||..     
  Fly   193 RGPHNLLRTVTVPIIHKKNCRAAYQ-PTAK---ITDSMICAAVLGRKDACTFDSGGPLVF----- 248

  Fly   302 PNRYELLGIVNFGFGC-GGPLPAAYTDVSQIRSWIDNCIQA 341
              :.::.|||:||.|| ....|..||||..::.:|:..|:|
  Fly   249 --KKQVCGIVSFGIGCASNRYPGVYTDVMYVKPFIEKSIKA 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 63/249 (25%)
Tryp_SPc 105..335 CDD:214473 62/247 (25%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 67/261 (26%)
Tryp_SPc 62..283 CDD:238113 67/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.