DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG6865

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:297 Identity:74/297 - (24%)
Similarity:124/297 - (41%) Gaps:62/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 QYPVQADNQPLPTECGHVNRIGVGFTITNARDI----AQKGELPWMVALLDSRSRLPLGGGSLIT 132
            |..:...|||    |          ::.|.:.:    |::.|:|:||:|:  |......||::|:
  Fly    18 QSQIAFSNQP----C----------SVRNPKIVGGSEAERNEMPYMVSLM--RRGGHFCGGTIIS 66

  Fly   133 RDVVLTSS----------TKTLEVPEKYLIVRAGEWDFESITE---------ERAHEDVAIRKIV 178
            ...:||:.          .|..::        .|.....||.|         :....|  .:.||
  Fly    67 ERWILTAGHCICNGLQQFMKPAQI--------QGVVGLHSIREYLNGIGNGPDALRVD--FKNIV 121

  Fly   179 RHTNLSVENGANNAALLFLARPLKLDHHIGLICL--PPPNRNFIHNRCIVSGWG--KKTALDNSY 239
            .|......:..::.|||.|.:|::...||...|:  ...:|:.......|||||  .:...:|..
  Fly   122 PHPQYDCNDVKHDIALLELVQPIRFSSHIQPSCVGSEEGHRSLEQEYGTVSGWGWTHENQAENDR 186

  Fly   240 MNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGK-DTCKGDGGAPLACPLQSDPN 303
            .::|:|..:.:.:...|:...:. .||...:..:.:|||.|.|: |:|..|.|.||.      ..
  Fly   187 SDVLRKATVKIWNNEACERSYRS-LGKSNTIGETQLCAGYENGQIDSCWADSGGPLM------SK 244

  Fly   304 RYELLGIVNFGFGCGGP-LPAAYTDVSQIRSWIDNCI 339
            .:.|:|:|:.|.||..| ||..||.||:..||:...|
  Fly   245 EHHLVGVVSTGIGCARPGLPGIYTRVSKYVSWMQKVI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 67/256 (26%)
Tryp_SPc 105..335 CDD:214473 66/254 (26%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 65/260 (25%)
Tryp_SPc 35..280 CDD:238113 67/263 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.