DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and proca

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_956650.1 Gene:proca / 393327 ZFINID:ZDB-GENE-060824-5 Length:434 Species:Danio rerio


Alignment Length:304 Identity:88/304 - (28%)
Similarity:138/304 - (45%) Gaps:46/304 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GNQGCESGQTCCPKTEI----LQYPVQA-DNQPLPTECGHVNRIGVGFTITNARDIAQKGELPWM 113
            |.|..::.:.|.||.:.    ::.|..| .|:|.|.....|....||          ::||.||.
Zfish   155 GYQLQDNSRKCTPKNDASCGQIRIPKSAYANKPKPVLQPWVMGGNVG----------KRGESPWQ 209

  Fly   114 VALLDSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIV 178
            ..:|:...|... ||.||..:.|||:: ..||...|: .||.|  |::....|.:...:.:::.:
Zfish   210 ALILNHLGRFHC-GGVLIDENWVLTAA-HCLETSSKF-SVRLG--DYQRFKFEGSEVTLPVKQHI 269

  Fly   179 RHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPN--RNFIHNR---CIVSGWGKKTALDNS 238
            .|...:.....|:.|||.|..|:|...:|...|||...  :..:|..   .|::||||......|
Zfish   270 SHPQYNPITVDNDIALLRLDGPVKFSTYILPACLPSLELAKRMLHRNGTVTIITGWGKNNQSATS 334

  Fly   239 YMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAG--GEPGKDTCKGDGGAPLACPLQSD 301
            |.:.|..:|||:||...|...:...      |.::::|||  |:. ||.|:||.|.|:.....  
Zfish   335 YNSTLHYVELPIVDNKECSRHMMNN------LSDNMLCAGVLGQV-KDACEGDSGGPMMTLFH-- 390

  Fly   302 PNRYELLGIVNFGFGCG-----GPLPAAYTDVSQIRSWIDNCIQ 340
             :.:.|:|:|::|.|||     |    .||.|:....|||:..|
Zfish   391 -DTWFLVGLVSWGEGCGQRDKLG----IYTKVASYLDWIDSVRQ 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 73/243 (30%)
Tryp_SPc 105..335 CDD:214473 71/241 (29%)
procaNP_956650.1 GLA 23..84 CDD:214503
EGF_CA 85..119 CDD:238011
FXa_inhibition 128..165 CDD:291342 2/9 (22%)
Tryp_SPc 195..427 CDD:238113 77/260 (30%)
Tryp_SPc 197..424 CDD:214473 73/255 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.