DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG6462

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:291 Identity:73/291 - (25%)
Similarity:120/291 - (41%) Gaps:43/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GCESGQTCCPKTEILQYPVQADNQPLPTECGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRS 121
            |.|:.:..|.|.|:      ..||.....    .||..|       ::|.:|..|:.|.|:...|
  Fly    52 GYENFRLRCEKFEM------EGNQTAAVR----TRIAGG-------ELATRGMFPYQVGLVIQLS 99

  Fly   122 RLPL--GGGSLITRDVVLTSS-TKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNL 183
            ...|  .||||||...|||:: ..|..:..|   :..|...|..:.:......|..|..:.:.:.
  Fly   100 GADLVKCGGSLITLQFVLTAAHCLTDAIAAK---IYTGATVFADVEDSVEELQVTHRDFIIYPDY 161

  Fly   184 SVENGANNAALLFLARPLKLDHHIGLICLPPP--NRNFIHNRCI-VSGWGKKTALDNSYMNILKK 245
            ....|.::.||:.|.|.::....:..|.|...  ::||:..:.: :||||......:....:|:.
  Fly   162 LGFGGYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQY 226

  Fly   246 IELPLVD--RSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELL 308
            ::..::|  |.:|.. |.|     .:.....:|..|..|:..|.||.|.|:....:   |...|:
  Fly   227 LDAEVIDQERCICYF-LPG-----LVSQRRHLCTDGSNGRGACNGDSGGPVVYHWR---NVSYLI 282

  Fly   309 GIVNFGF--GC--GGPLPAAYTDVSQIRSWI 335
            |:.:||.  ||  ||  |..||.::....||
  Fly   283 GVTSFGSAEGCEVGG--PTVYTRITAYLPWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 63/243 (26%)
Tryp_SPc 105..335 CDD:214473 61/241 (25%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 64/255 (25%)
Tryp_SPc 77..314 CDD:238113 65/256 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457614
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.