DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG1299

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster


Alignment Length:351 Identity:105/351 - (29%)
Similarity:163/351 - (46%) Gaps:57/351 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KECVQ-----RNRCRIGTETGRPIIDFRGLNNGNQGCES--GQTCCPKTEILQYPVQADNQPLPT 84
            |||..     |:|.:..|     ..:|  |...|..|::  .|.|||..:.:.....|.:|.:|.
  Fly   178 KECASLLNELRSRSQDAT-----FANF--LRASNAVCQNKGTQVCCPTGQGITNTTPAPSQIVPK 235

  Fly    85 ECGHVNR------IGVGFTITNAR-----DIAQKGELPWMVALL--DSRSRLPLG-GGSLITRDV 135
            ....:.|      .|.|.|:...:     ::::||..|| :|||  |..|..|.. ||:|||...
  Fly   236 NTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPW-IALLGYDDPSGSPFKCGGTLITARH 299

  Fly   136 VLTSSTKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARP 200
            |||::..   :.:....||.||.|..:.| |..|.|:.|.:.|.|.:.:..||.::.|:|:|.|.
  Fly   300 VLTAAHC---IRQDLQFVRLGEHDLSTDT-ETGHVDINIARYVSHPDYNRRNGRSDMAILYLERN 360

  Fly   201 LKLDHHIGLICLPPP----NRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQ 261
            ::....|..||||..    .::::.....|:||| ||........:|.::::|:.|..||...  
  Fly   361 VEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWG-KTMEGGESAQVLNELQIPIYDNKVCVQS-- 422

  Fly   262 GPYGKD---FI---LDNSLICAGG-EPGKDTCKGDGGAPLACPLQSDPN----RYELLGIVNFGF 315
              |.|:   |.   .|.:::|||. ..|||||:||.|.||..|   :|.    |:.|:|:|::|.
  Fly   423 --YAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLP---EPYQGQLRFYLIGVVSYGI 482

  Fly   316 GCGGP-LPAAYTDVSQIRSWIDNCIQ 340
            ||..| :|..|:.......||...:|
  Fly   483 GCARPNVPGVYSSTQYFMDWIIQQVQ 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 83/250 (33%)
Tryp_SPc 105..335 CDD:214473 81/248 (33%)
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 11/44 (25%)
Tryp_SPc 260..503 CDD:214473 81/255 (32%)
Tryp_SPc 261..503 CDD:238113 81/254 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.