DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG14990

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:259 Identity:116/259 - (44%)
Similarity:158/259 - (61%) Gaps:5/259 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 QPLPTE-CGHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKT 143
            ||.|.: ||..|..|:...:...:|.:..|:.||:|||. |:.:. .|.||||..:||||:::..
  Fly    41 QPDPNQVCGMSNPNGLVANVKVPKDYSTPGQFPWVVALF-SQGKY-FGAGSLIAPEVVLTAASIV 103

  Fly   144 LEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIG 208
            :...:..::||||||:....:|....||..:.::|:|...|...||||.||||||.|.:|..||.
  Fly   104 VGKTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIR 168

  Fly   209 LICLPPPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGP-YGKDFILDN 272
            .||||...|:|...||:|:||||....|.:|.||.||||||:::|:.||.:|:.. .|..|.|..
  Fly   169 TICLPSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPA 233

  Fly   273 SLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGP-LPAAYTDVSQIRSWI 335
            ||||||||.....|.||||:.|.||:::||:|||..||||:|.||... :||.||:|...|.||
  Fly   234 SLICAGGEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDWI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 108/233 (46%)
Tryp_SPc 105..335 CDD:214473 106/231 (46%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 108/233 (46%)
Tryp_SPc 67..297 CDD:214473 106/231 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471539
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.