DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and KLKB1

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:387 Identity:105/387 - (27%)
Similarity:153/387 - (39%) Gaps:99/387 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QRNRCRIGT-ETGRPI--------------------------------IDFRG--LN----NGNQ 56
            |||.|.:.| |:|.|.                                :||.|  ||    .|..
Human   263 QRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVN 327

  Fly    57 GCESGQTCCPKTEILQYPVQADNQPLPTEC--------------GHVNRIGVG------------ 95
            .|:...|...:.:...|.:      ||.:|              |...||..|            
Human   328 VCQETCTKMIRCQFFTYSL------LPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLC 386

  Fly    96 --------FTITNARDI----AQKGELPWMVAL-LDSRSRLPLGGGSLITRDVVLTSSTKTLEVP 147
                    .|.|:.|.:    :..||.||.|:| :...::..|.|||||....|||::.....:|
Human   387 NTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLP 451

  Fly   148 -EKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLIC 211
             :....:.:|..:...||::.....  |::|:.|.|..|..|.::.||:.|..||........||
Human   452 LQDVWRIYSGILNLSDITKDTPFSQ--IKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPIC 514

  Fly   212 LPPP-NRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLI 275
            ||.. :.:.|:..|.|:|||.... .....|||:|:.:|||....||.:.|     |:.:...::
Human   515 LPSKGDTSTIYTNCWVTGWGFSKE-KGEIQNILQKVNIPLVTNEECQKRYQ-----DYKITQRMV 573

  Fly   276 CAG-GEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCG-GPLPAAYTDVSQIRSWI 335
            ||| .|.|||.||||.|.||.|   .....:.|:||.::|.||. ...|..||.|::...||
Human   574 CAGYKEGGKDACKGDSGGPLVC---KHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWI 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 78/236 (33%)
Tryp_SPc 105..335 CDD:214473 76/234 (32%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519 8/31 (26%)
APPLE 303..386 CDD:128519 16/88 (18%)
Tryp_SPc 401..632 CDD:214473 77/241 (32%)
Tryp_SPc 402..632 CDD:238113 76/240 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.