DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and tpr

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:262 Identity:73/262 - (27%)
Similarity:125/262 - (47%) Gaps:33/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 CGHVN---RIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGG-----GSLITRDVVLTSSTK 142
            ||..|   || ||...|...      :.||:..||       .||     .||:....:||:|..
  Fly   118 CGIANIQKRI-VGGQETEVH------QYPWVAMLL-------YGGRFYCAASLLNDQFLLTASHC 168

  Fly   143 TLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHI 207
            .....::.:.||..|.|.:....::....||  :::.|...:..|..|:.|::.|..|::.:..:
  Fly   169 VYGFRKERISVRLLEHDRKMSHMQKIDRKVA--EVITHPKYNARNYDNDIAIIKLDEPVEFNEVL 231

  Fly   208 GLICLPPPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDN 272
            ..:|:|.|.|:|.....||:||| ...:.....:.|:::::|::.:..|:   :..||.. |.||
  Fly   232 HPVCMPTPGRSFKGENGIVTGWG-ALKVGGPTSDTLQEVQVPILSQDECR---KSRYGNK-ITDN 291

  Fly   273 SLICAG-GEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCG-GPLPAAYTDVSQIRSWI 335
             ::|.| .|.|||:|:||.|.||.. :.|....:::.|:|::|.||. ...|..|..|::..:||
  Fly   292 -MLCGGYDEGGKDSCQGDSGGPLHI-VASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWI 354

  Fly   336 DN 337
            .|
  Fly   355 KN 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 64/238 (27%)
Tryp_SPc 105..335 CDD:214473 62/236 (26%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 67/250 (27%)
Tryp_SPc 127..356 CDD:238113 68/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457681
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.