DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG11192

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:254 Identity:76/254 - (29%)
Similarity:126/254 - (49%) Gaps:35/254 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 DIAQKGELPWMVAL-LDSRSRLPLGGGSLITRDVVLTSSTKTLEVP--EKYLIVRAGEWDFESIT 164
            ::|...|.|:.|:: |..|.   :.||::|..|.|||:: ...|.|  .....||.|..:.||  
  Fly    32 EVATIQEFPYQVSVQLQGRH---ICGGAIIGIDTVLTAA-HCFEDPWSSADYTVRVGSSEHES-- 90

  Fly   165 EERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICL----PPPNRNFIHNRCI 225
               ....:::|:::.|.:.:.::..|:.|||.|...|....|:..:.|    .||..:   .|..
  Fly    91 ---GGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTAD---TRLQ 149

  Fly   226 VSGWG---KKTALDNSYMNI---LKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKD 284
            |||||   :::|:... :.:   |:.:::.||:.:.|:.    .|.:...:...:||| ..||:|
  Fly   150 VSGWGFQAEESAVSGE-VGVSPQLRFVDVDLVESNQCRR----AYSQVLPITRRMICA-ARPGRD 208

  Fly   285 TCKGDGGAPL-ACPLQSDPNRYELLGIVNFGFGCGGP-LPAAYTDVSQIRSWIDNCIQA 341
            :|:||.|.|| ....:..|.|  |.|||::|.||..| .|..||:|:..|||||..:.|
  Fly   209 SCQGDSGGPLVGYAAEEGPAR--LYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQLDA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 74/246 (30%)
Tryp_SPc 105..335 CDD:214473 72/244 (30%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 72/246 (29%)
Tryp_SPc 28..262 CDD:238113 75/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.