DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG4927

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:379 Identity:92/379 - (24%)
Similarity:153/379 - (40%) Gaps:65/379 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLLVLGFSRIQALFCGGSMAKECVQRNRCRIGTETGRPIIDF--RGLNNGNQGCESGQ--TCC- 65
            |||::.....|.:.||.....:       |:..:.|..|.|.|  ..:.|..:.|:...  .|| 
  Fly     7 ILLILAVICSILSEFCDNGTGE-------CKELSATDCPSIFFNLHLIRNFVKYCDKSNHIVCCL 64

  Fly    66 ------PKTEILQYPVQADNQPLPTECGHVNRIGVG-----FTITNARDIAQKGELPWMVALLDS 119
                  |:::  |:......:....||...|.|...     |.:..|:  |...|.|:| |||..
  Fly    65 LPNNMQPQSQ--QFSANIGLRRFEKECRRFNEIRTSCRTTPFIVGGAK--AAGREFPFM-ALLGQ 124

  Fly   120 R----SRLPLGGGSLITRDVVLTSSTKTLEVPE-------------KYLIVRAGEWDFESITEER 167
            |    |::....|::|.....:.::...||..|             || :||.||.|:.|.|::.
  Fly   125 RGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKY-VVRLGELDYNSTTDDA 188

  Fly   168 AHEDVAIRKIVRHTNLSVENGA----NNAALLFLARPLKLDHHIGLICLPPPNRNFIHNRCIVSG 228
            ..:|..:...|.|.....::..    |:.|::.|........::...|||....| ...:...:|
  Fly   189 QPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEMEATFSEYVAPACLPLDGGN-EQLQVAAAG 252

  Fly   229 WGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILD-NSLICAGG-EPGKDTCKGDGG 291
            ||..:...::..::| |:.|...|.:.|..:|:..      :| .:.:|||. ....|||.||.|
  Fly   253 WGATSESGHASSHLL-KVSLDRYDVAECSQRLEHK------IDVRTQLCAGSRSTSADTCYGDSG 310

  Fly   292 APLAC--PLQSDPNRYELLGIVNFGFGCG-GPLPAAYTDVSQIRSWIDNCIQAE 342
            .|:..  |:.|...  :::||.::|..|| ..||:.||.|.....||:|.:..|
  Fly   311 GPVFVQHPIYSCLK--QVIGITSYGLVCGVQGLPSVYTKVHLYTDWIENIVWGE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 67/257 (26%)
Tryp_SPc 105..335 CDD:214473 65/255 (25%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 68/266 (26%)
Tryp_SPc 105..355 CDD:214473 66/263 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.