DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and Prss39

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:XP_006244779.1 Gene:Prss39 / 363215 RGDID:1309276 Length:371 Species:Rattus norvegicus


Alignment Length:351 Identity:85/351 - (24%)
Similarity:143/351 - (40%) Gaps:91/351 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ADNQPLPTECG----------HVNRI---------------GVGFTITN---------ARDIAQK 107
            |..:|||..|.          |:.|:               |:..|:..         ...||:.
  Rat    16 APKEPLPATCAGLQALTNTSTHIGRLAQTNGPCPEGKCLVAGIVSTVCGKTKFQGKIYGGSIAKA 80

  Fly   108 GELPWMVALLDSRSRLPLGGGSLITRDVVLTSS---TKTLEVPEKYLIVRAGEWDFESITEERAH 169
            ...||..:|: .|.| .:.|..||.::.|.:::   .::|: |..|.|:....   |........
  Rat    81 ERWPWQASLI-FRGR-HICGAVLIDKNWVASAAHCFKRSLK-PSDYRILLGYN---ELSNPSNYS 139

  Fly   170 EDVAIRKIVRHTNLS-VENGANNAALLFLARPLKLDHHIGLICLP------PPNRNFIHNRCIVS 227
            ..:.:.|::.|.:.: :.:...:..|:.|..|::...||..:|:|      |.:.:     |.:|
  Rat   140 RQMTLSKVIVHEDYNKLHSQEKDIVLIQLHLPVRYSSHIFPVCVPDQTTKEPSDES-----CWIS 199

  Fly   228 GWGKKTALDNSYMNILKKIELPLVDRSV-------CQTKLQGP------YGKDFILDNSLICAGG 279
            |||..|  |:.::    :...||:|..|       |:...|.|      |  |.|.|: :||||.
  Rat   200 GWGMVT--DDKFL----QAPFPLLDSEVFLMNDQECEAFFQTPQISITEY--DAIKDD-MICAGD 255

  Fly   280 EPG-KDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGPL--PAAYTDVSQIRSWIDNCIQA 341
            ... |.||:||.|.||.|.|.|   .:.|:|:.::...|..|:  |:.:|.||....||:. .:|
  Rat   256 ITNQKSTCRGDSGGPLVCLLDS---YWYLVGLASWSGACLEPIHSPSIFTRVSHFSDWIEK-KKA 316

  Fly   342 EAVHYSPQLGNVGQSPAPLDRYIPNI 367
            :.....|.|       |||:...|::
  Rat   317 DTPDVDPSL-------APLEETAPSL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 68/257 (26%)
Tryp_SPc 105..335 CDD:214473 66/255 (26%)
Prss39XP_006244779.1 Tryp_SPc 71..311 CDD:214473 67/262 (26%)
Tryp_SPc 72..314 CDD:238113 69/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.