DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4793 and CG1773

DIOPT Version :9

Sequence 1:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster
Sequence 2:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster


Alignment Length:324 Identity:80/324 - (24%)
Similarity:119/324 - (36%) Gaps:84/324 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GQTC--CPKT-----------EILQYPVQADNQPLPTECGHVNRI----GVGFTITNARDIAQKG 108
            |..|  ||.:           |:|.|     .|....:||.::.:    .:...||..|    |.
  Fly    13 GILCLSCPPSSQAGREDWTPHELLAY-----EQLTQQDCGVLSNLIPAQRLRRRITGGR----KS 68

  Fly   109 EL---PWMVAL-LDSRSRLPLGGGSLITRDVVLTSSTKTLEVP-EKYLIVRAGEWDFESITEERA 168
            .|   |||..| :.....:...||||::...|||::......| .|.:.|..||.|..|.::...
  Fly    69 SLLSQPWMAFLHISGDIEMCRCGGSLLSELFVLTAAHCFKMCPRSKEIRVWLGELDISSTSDCVT 133

  Fly   169 H----------EDVAIRKIVRHTNLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRNF---- 219
            :          |:..|.|.:.|...::.....:.||:.|.:.:....||..||||..:...    
  Fly   134 YNYQRVCALPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTL 198

  Fly   220 -IHNRCIVSGWGKKTA--LDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEP 281
             :....:..|||:..:  ..||.|.:       .::...|..      |:    |.|.:||.|: 
  Fly   199 QLGQSYMAVGWGRTESRRFANSTMEV-------HINTEKCTD------GR----DTSFLCANGD- 245

  Fly   282 GKDTCKGDGGAPL---------ACPLQSDPNRYELLGIVNFGF-GCGGPLPAAYTDVSQIRSWI 335
            ..|||.||.|.||         |..:|        .|:|:.|. .||....|.|.||.....||
  Fly   246 YVDTCTGDSGGPLIWKTTLFGKARTVQ--------FGVVSTGSQNCGAGQKAYYMDVPTYVPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 67/263 (25%)
Tryp_SPc 105..335 CDD:214473 65/261 (25%)
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 68/269 (25%)
Tryp_SPc 62..301 CDD:238113 68/268 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.